KEGG   Bacillus pumilus SAFR-032: BPUM_1862Help
Entry
BPUM_1862         CDS       T00599                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00020  Citrate cycle (TCA cycle)
bpu00310  Lysine degradation
bpu00380  Tryptophan metabolism
bpu01100  Metabolic pathways
bpu01110  Biosynthesis of secondary metabolites
bpu01120  Microbial metabolism in diverse environments
bpu01130  Biosynthesis of antibiotics
bpu01200  Carbon metabolism
Module
bpu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BPUM_1862
  09105 Amino acid metabolism
   00310 Lysine degradation
    BPUM_1862
   00380 Tryptophan metabolism
    BPUM_1862
Enzymes [BR:bpu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BPUM_1862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N DUF2680 Herpes_UL21
Motif
Other DBs
NCBI-ProteinID: ABV62533
UniProt: A8FE66
LinkDB All DBs
Position
complement(1926055..1928889)
Genome map
AA seq 944 aa AA seqDB search
MFQNDVKQPLSWEEFHGPNLGYVLELYDQYVQDPTSVDEDLRGIFDELGAPPSEMKEEIG
KKENSVVTSEQIQKIASVVKLAEDIRTYGHLNASVNPLRKEKELQELFPLKEYGLTEEDV
KNIPISIISPDAPKHISNGIEAINHLRNTYKRTISFEFDHVHDFEERNWLSKSIESGELF
KKKPADKLVSVFKRLTEVEQFEQFLHKTFVGQKRFSIEGLDALVPVLDEIISESVTQGTS
NINIGMAHRGRLNVLAHVLGKPYEIIFSEFQHAPNKELVPSEGSIGISYGWTGDVKYHLG
ADRQIKDEDTKSARVTLANNPSHLEFIDPIIEGSTRAAQELRTQKGYPAQDVEKALAILI
HGDAAFPGEGIVAETLNLSQLVGYQVGGTIHIIANNMIGFTTESNESRSTKYASDLAKGF
EIPIVHVNADDPEACLAAVQLAVEYRKRFKKDFLIDLIGYRRYGHNEMDEPSTTQPMLYD
AVRKHKTVKNIFADKLVSEGLLTKEQREEIEQAVATRIEEAYQKVPSKKEHTIQEIELPE
PVSNGFPAVDTSVEFDVLRKLNEELISWPDDFQVFGKLKRILEKRAKVFTDDRKVEWSLG
EALAFASILKDGTPIRMTGQDSERGTFAQRNLVLHDSQTGNEFIALHELSDANASFTVHN
SPLSEGSVIGFEYGYNVYSPETLVIWEAQFGDFANAAQVYFDQFISAGRAKWGQKSGLVM
LLPHGYEGQGPEHSSGRTERFLQSAAENNWTVANLTSAAQYFHILRRQAKMLLREEIRPL
VIMTPKSLLRNPNSLSEVQELTDGQFQPVLEQPGLVHDHEKVSRLVLSSGKVSIDISDRF
TQMEEPKDWLHIARVEQLYPFPAKDIKAILSKLTNLEEIVWTQEEPQNMGAWGYIEPYLR
EIAPEKVKVRYIGRRRRSSTAEGDPTVHKKEQERIVSDSLTRKN
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaaatgatgtgaaacaaccgttgagttgggaagaatttcatggtccgaacctc
ggctatgtgctcgagctctacgatcagtatgtccaggatcctactagtgttgatgaagat
ctaagaggcatatttgatgaacttggtgcaccaccgagtgaaatgaaggaggaaattggg
aaaaaagaaaatagcgtagttacttctgaacaaatccaaaagatagcatcagtcgttaaa
ctggcagaagacatcagaacgtatggccatttaaatgcttccgtcaatcctcttcgcaaa
gaaaaggaattacaagagctgtttcctttaaaggagtacggcttaacagaagaagacgtc
aagaatattccaatatctattattagtcctgacgcaccaaaacacatttcaaacggcata
gaagccattaaccatttgagaaatacgtataagcgtacgatttcatttgagtttgatcac
gtacatgatttcgaagagcggaactggctctcaaaatcaatcgagtctggtgaattattt
aagaaaaaaccagccgataaactagtttctgtattcaagagattaacagaagttgagcag
ttcgaacagtttcttcataaaacatttgttgggcaaaagcgcttctcgatagaaggttta
gacgcacttgtcccagtacttgatgaaattatttcagagtctgttacacaagggacttca
aatattaacattggaatggcacacagaggccgtttaaatgtattagcacatgtgttagga
aagccatatgagattattttctcggaattccagcatgcgccgaataaagagctcgttcca
tcagaaggctctattggcatcagctacggatggactggtgatgtaaagtaccatctagga
gcggatcgtcaaattaaagacgaagatacaaagagtgcgagagtcacgcttgctaataac
ccaagtcacctagaattcattgatccaatcattgaaggtagcacacgtgccgctcaggaa
ttgcgtactcaaaagggatatccagctcaagacgttgaaaaggcattagccatcttaatt
catggtgatgcagcatttcctggagaaggaattgtggcagaaacattaaatttaagtcaa
cttgtaggctatcaagtgggtggaacgatccatatcattgcaaacaatatgatcggattt
acgacggaaagcaatgaatctcgctcaacgaaatatgcaagtgaccttgcaaaagggttt
gagattccaattgttcacgtcaatgcagatgatccagaagcatgtttagcagctgttcaa
ttagctgtggaataccgcaaacgctttaagaaggatttcttaattgacttgatcggttac
cgcagatatggtcataacgaaatggatgagccttctacgactcagccgatgctatacgat
gccgtcagaaagcacaaaacggtcaagaatatctttgcagataaacttgtctcagaaggt
cttctaacgaaagaacagcgtgaagaaatcgagcaggctgtagcgacgagaatagaagaa
gcctatcaaaaggtgccttcaaagaaagagcatacgattcaagaaattgaactgccagaa
ccagtatcaaatggcttcccagcagtggatacatcggtagaatttgatgtattacgtaag
ctgaatgaagaattgatcagctggccggacgatttccaagtatttggtaagcttaaacgg
atccttgaaaaacgggcaaaagtgtttacagatgaccgtaaagtagaatggtcacttgga
gaagcacttgcatttgcatctatattaaaagacggtacgccaattcgaatgaccggacag
gattcagagcgcggtacttttgctcaaagaaaccttgttcttcacgacagtcaaactgga
aatgaatttattgctcttcatgagctaagtgatgcaaacgcatcatttactgttcataat
agtccactgtcagagggctcagtcatcgggtttgaatatggttataatgtctattctcct
gaaacgttagtcatttgggaggctcaatttggagacttcgcaaatgcggctcaagtgtat
ttcgatcaatttatttcggctggacgtgcaaaatggggacaaaaatcaggtctagtgatg
ctcttgcctcatggatatgaaggacaaggtcctgagcattcaagtggaagaacagagcga
ttcctgcaatcagctgctgagaataactggacagtggcgaacctcacaagtgcagcgcaa
tacttccacattctaagaagacaggcgaagatgctgcttcgcgaagagattcgtccgctt
gtcatcatgacaccgaagagtctgcttcgtaacccgaactcattgtctgaagtccaggaa
ttaacggatggacagttccaaccagttcttgaacaaccaggccttgtgcatgatcatgaa
aaagtatcgcgccttgtgctatctagcgggaaggtatccattgatattagtgatcgtttt
actcaaatggaagagccgaaagattggcttcacattgcgagagtggaacaactatatcca
ttcccagccaaagatattaaagcgattttatcaaaactaacaaacttagaagaaatcgta
tggacgcaagaagagccacaaaatatgggggcttggggatacattgagccatatttacgt
gaaattgcgcctgaaaaagtaaaagtacgttacatcggccgaagaagacgttcaagtacg
gctgagggcgatccaactgtgcataaaaaagaacaagaacgaattgtatctgatagcttg
actcgcaaaaactaa

DBGET integrated database retrieval system