KEGG   Bacillus pumilus SAFR-032: BPUM_3325Help
Entry
BPUM_3325         CDS       T00599                                 

Definition
(GenBank) ATP synthase F0F1 subunit epsilon
  KO
K02114  F-type H+-transporting ATPase subunit epsilon
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00190  Oxidative phosphorylation
bpu01100  Metabolic pathways
Module
bpu_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:bpu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BPUM_3325
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:bpu00194]
    BPUM_3325
Photosynthesis proteins [BR:bpu00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   BPUM_3325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_DE_N ATP-synt_DE PAS
Motif
Other DBs
NCBI-ProteinID: ABV63978
UniProt: A8FIB1
LinkDB All DBs
Position
complement(3306413..3306808)
Genome map
AA seq 131 aa AA seqDB search
MKTVQVNIVTPDGPVYQADVEMVSVRAESGELGILAGHVPMVAPLKIGAVRLKHSGSTEL
VAVSGGFVEVRPEQVTILAQAAETSDKVDVDRAKSAKQRAEEHLNHPNESDVRRAELALK
RALNRLNVAGK
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccgttcaagtcaatatcgttactcccgacggcccagtgtatcaagcggatgtg
gaaatggtcagtgtcagagcagaaagcggtgagcttggtattttagctggccacgttcca
atggttgctccgctaaaaatcggtgcagttcgcttaaaacatagtggatcaactgaattg
gttgcagtaagtggcggatttgttgaagttcgccctgaacaagtaaccattcttgctcag
gccgctgaaacatcagataaagttgatgtcgatcgtgcgaaatcagcgaaacagcgtgct
gaagagcatttgaaccacccgaatgaaagtgatgtacgccgggcggaactcgcattaaaa
cgggcgttaaaccgtttaaatgtagcagggaaataa

DBGET integrated database retrieval system