KEGG   Bacillus pumilus SAFR-032: BPUM_3424
Entry
BPUM_3424         CDS       T00599                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K19549  bacilysin biosynthesis transaminase BacF [EC:2.6.1.-]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00998  Biosynthesis of various secondary metabolites - part 2
bpu01100  Metabolic pathways
bpu01110  Biosynthesis of secondary metabolites
Module
bpu_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bpu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BPUM_3424
Enzymes [BR:bpu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     BPUM_3424
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-ProteinID: ABV64075
UniProt: A8FIK8
LinkDB
Position
3393787..3394983
AA seq 398 aa
MVKILPSNMIERLPEQKFGTVFEKIAHKTQQGANIINLGQGNPDLPTPAHIVCALQEAAG
SLPFQQYAPFRGFDFFKQAIADFYRKEFSIEVDPKKEIALFTGGKTGLYVMSQCLLDPGD
IAFVPDPGYPEYHSGILMADAKPYCIRLEEENGYLPNFSSIDPGVLKKAKVLFLNYPNNP
TGAVANEAFFEEAAAFASTHGLHVIHDFAYGSFHYEQKPISFLKAPLGKNVGVELYSLSK
TFNMAGWRVAFAVGNEDIIHAINAFQDHIFVSMYGGFQHAATVALQSDDSHIQSLKEVYL
ERMTFFIRQAEKQLGWTIARPAGAFYLWAPIPDEFEDSHTFADYLLEHADVVVTPGGVFG
THGRRHVRISMVAPIEQLALFIDRLHILPIRFHQKTRI
NT seq 1197 nt   +upstreamnt  +downstreamnt
gtggtgaagatcttaccatctaacatgattgaacggctaccagaacaaaaatttggaacc
gtgtttgagaaaatagcgcataaaacacaacagggagcgaacatcattaaccttggtcag
ggaaatcccgatcttcctacccctgcacatattgtgtgtgctcttcaagaagcagcaggc
tctttgccatttcagcaatatgcaccttttagaggctttgactttttcaagcaagctatt
gcggatttctacagaaaggaatttagtatcgaggttgacccgaagaaggaaattgccctt
ttcactggaggaaaaacaggcctttatgtaatgagtcagtgtctgcttgatccaggggac
attgcctttgtccccgatcctggatacccagaatatcattcaggtatcttaatggcagat
gcaaagccatactgcatccggctagaagaggaaaatggctatttgccgaatttctcatca
attgatccaggcgtgttaaaaaaggcaaaggtccttttcttaaattatccgaataaccca
acaggtgcggtggcaaatgaggctttttttgaagaggctgcggcatttgcctctactcac
ggtcttcatgtgattcatgattttgcttatggctcctttcattacgagcaaaaacctata
agctttctaaaagctcctcttggaaaaaacgtaggcgtggaactatattctttatccaaa
acattcaatatggcaggatggagagtcgcttttgctgtaggcaatgaggacatcattcat
gccattaacgctttccaagatcatatatttgtcagtatgtatggcggatttcagcatgcc
gccaccgtcgctttacaaagtgatgactctcatattcaatctttgaaagaagtctacctt
gaacgaatgactttcttcatccgtcaagctgagaagcaacttggctggaccattgcacgt
ccagccggcgccttttatttgtgggcaccgattcctgatgaattcgaggattcccataca
tttgccgactatttactcgagcatgcagatgtcgtcgtgacgcctgggggtgtttttggc
acacacggaagacgtcatgtccgcatctcaatggtggcgccaattgaacagcttgctctc
tttatcgatcggctgcatatcctgccgattcgctttcatcaaaaaacccgcatatag

DBGET integrated database retrieval system