KEGG   Bacillus pumilus MTCC B6033: BW16_02580Help
Entry
BW16_02580        CDS       T03175                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bpum  Bacillus pumilus MTCC B6033
Pathway
bpum00473  D-Alanine metabolism
bpum01100  Metabolic pathways
bpum01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bpum00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BW16_02580
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BW16_02580
Enzymes [BR:bpum01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BW16_02580
Peptidoglycan biosynthesis and degradation proteins [BR:bpum01011]
 Precursor biosynthesis
  Racemase
   BW16_02580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AHL70369
UniProt: W8QK71
LinkDB All DBs
Position
528476..529657
Genome map
AA seq 393 aa AA seqDB search
MDTNAFYRDTWAEIDLTAIKHNVSHMKDHIGQSVQLMAVVKANAYGHGDIEVARAALEAG
ADLLAVAFLDEAISLRNKGIKAPILVLGAVPPEYVKVAVRYNVIMTAYSIDWLREVVKVM
KGQMGQPIRFHLKIDSGMNRLGVKTIEQVSEVKELVHAHSFLQLEGVFTHFATADEKDEN
YFGMQVDTFKTLLQPLHTDKLLIHCANSAAGLRFKDTLFNMVRFGISMYGLSPSEEIKDE
LPFKLEEALSLHTKLAHVKPIQKGESVSYGATYTANQDTWIGTIPIGYADGWIRKLAGTE
VLIGGKRRKIAGRVCMDQFMVDLKKDIPAGEPVVLIGTQGEDKISVDEIAKRLETINYEV
TCSVGYRVPRVYIEDGERVHVRNPLLQGGPSFL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggacacaaatgccttttatagagacacatgggcagaaattgatttaacagcaatcaag
cataatgtttcacatatgaaagaccatattggtcaaagcgtccaactaatggctgttgtg
aaagccaatgcatatggacatggagatatagaagtggcaagagctgccctcgaagcagga
gcagacctattagccgtcgcttttttagatgaagccatttctttaagaaataaaggcatc
aaagccccgattcttgtgctcggtgcagtaccaccagagtatgtcaaagtggcagtcagg
tacaatgtgatcatgaccgcttactcgatcgattggctaagagaagtcgtcaaagtgatg
aaagggcagatgggacaacccattcgtttccacttgaaaatcgacagcggcatgaatcgg
ttaggtgtgaaaacaatcgagcaggtgagcgaagtaaaagagcttgtccacgctcattct
tttttacagctggaaggagtatttactcactttgccacagcggatgaaaaagatgaaaac
tacttcggtatgcaggttgatacgtttaaaacattgcttcaaccgcttcatacggacaaa
ctgctcattcattgcgccaacagtgcagccggtctaaggtttaaagacactttatttaat
atggttcgttttggcatcagtatgtacgggctgtcgccgtcggaagaaatcaaagatgaa
ttgccgtttaaactggaagaagcattatctcttcatacaaaacttgcacatgtaaagccc
attcaaaagggtgagagcgtgagctatggtgcaacttatacagcgaatcaagatacttgg
attggtacgattccaatcgggtatgcagacggctggatcaggaagcttgccggaacagaa
gtgctcattggcggaaaacgccgaaagattgctggaagggtgtgtatggatcaattcatg
gttgatttgaaaaaggacattccggcaggggagccagtcgtgctcatcgggacacaaggc
gaagacaagatatctgtcgatgaaatagccaagcggcttgaaaccattaactacgaagtc
acatgttctgttggctaccgcgtcccaagagtctatatagaggacggcgaaagggttcat
gtacgaaatccgctgcttcaaggcggtccaagctttttataa

DBGET integrated database retrieval system