KEGG   Bacillus pumilus MTCC B6033: BW16_05630Help
Entry
BW16_05630        CDS       T03175                                 

Definition
(GenBank) iron ABC transporter permease
  KO
K02015  iron complex transport system permease protein
Organism
bpum  Bacillus pumilus MTCC B6033
Brite
KEGG Orthology (KO) [BR:bpum00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpum02000]
    BW16_05630
Transporters [BR:bpum02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter
    BW16_05630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecCD Phage_holin_5_2
Motif
Other DBs
NCBI-ProteinID: AHL70881
UniProt: W8RG68
LinkDB All DBs
Position
1073788..1074738
Genome map
AA seq 316 aa AA seqDB search
MKLYQLSLLFVCLACASLFVGVQDLSLLQLFHLSDEQMNTLFSSRIPRLMSIVLAGMSLS
LCGFIMQSMTRNKFVSPTTAGTMDWAKLGILTAMLVFTQASPLMKMAIAFLFTLAGNLLF
LKILRHIKVNDTIYVPLVGLMFGGIVSSISTFIAYKYDLIQNVSAWLQGDFSLIVQGRYE
LLYVSVPLLIIAYLYADRFTVAGMGESFAVNLGLTYKRVMAVGLVIVSMITSVTILTVGM
LPFLGLIIPNIVSIYRGDHLKKSLPHTALLGAIFVLICDVLGRVIIYPYEISVGLMVGII
GSAIFLYMLLRRKRYA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgtaccaattaagtttgttgtttgtgtgtttggcatgtgcgtcgctgtttgtc
ggagtacaggacctgtctcttttacagttgtttcatctatcagatgaacaaatgaacacc
ttattttcaagtcgcatcccgcggctgatgagtattgtgcttgctggcatgagcctgagc
ttatgcggttttatcatgcaaagcatgacgagaaataaatttgtctctccaacgactgca
ggaacaatggattgggccaagctgggtattttaaccgccatgcttgtttttacacaggca
agcccgctgatgaaaatggcgattgcgtttttatttacgttagctggcaatctattattc
ttaaaaattttacgccatattaaggtgaacgatacgatctacgtaccgttagtcggctta
atgtttggcggaattgtcagttcaatttccacgtttatagcctataaatatgatttgatc
caaaacgtatccgcatggctgcaaggggatttttctcttattgttcagggacgttatgaa
ctgctctatgtgagtgttcctctattgatcatcgcgtatttatatgctgaccgctttaca
gtggctggtatgggtgagagctttgccgtcaatttaggtttaacgtataaacgtgtcatg
gcagttggtttggtgattgtttcgatgattacttctgtaacgattttgactgttggcatg
ctgccattccttggcttaatcattccgaatattgtatcgatctaccgaggggatcacttg
aaaaagagcctgccgcatacggctttattaggggccatttttgtgctcatatgtgacgta
ctcggacgggtgatcatttatccatatgaaatatctgtcgggcttatggtcggcatcatt
ggaagtgcgatcttcctgtacatgttattaaggaggaagcgctatgcataa

DBGET integrated database retrieval system