KEGG   Bacillus pumilus MTCC B6033: BW16_07060Help
Entry
BW16_07060        CDS       T03175                                 

Definition
(GenBank) aminotransferase
  KO
K08969  aminotransferase [EC:2.6.1.-]
Organism
bpum  Bacillus pumilus MTCC B6033
Pathway
bpum00270  Cysteine and methionine metabolism
bpum01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpum00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BW16_07060
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bpum01007]
    BW16_07060
Enzymes [BR:bpum01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     BW16_07060
Amino acid related enzymes [BR:bpum01007]
 Aminotransferase (transaminase)
  Class I
   BW16_07060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Alliinase_C
Motif
Other DBs
NCBI-ProteinID: AHL71146
UniProt: W8RH03
LinkDB All DBs
Position
1334400..1335590
Genome map
AA seq 396 aa AA seqDB search
MEFQQSDVLKHLPKQFFASLVQKVQKKMQEGADVINLGQGNPDQPTPPHIVKAMQEAVAK
PENHQYSSFRGTAKLKKAAAAFYEREYGVTLDPKTEIAILFGGKAGLVELPQCLLNPGDT
LLVPDPGYPDYWSGAVLAGAHMVTMPLLEQNDFLPDYHQLSEEDKNQAKLMYLNYPNNPT
GATATRTFFEDTVAFASENNMCVVHDFAYGGIGFDGEKPLSFLQIDGAKETGIEIYTLSK
TYNMAGWRVGFAAGNASVIEAIELYQDHLFVSLFKATQDAAAEALLSDQTCVQLQNDRYE
NRRNTWIAACKEIGWDVSAPKGSFFAWLKVPEGYTSETFSDVLLEKAHVVVAPGNGFGAH
GEGYVRVGLLTSEERLKEAADRIAALQLFEKKPLTT
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggaattccagcaatcagatgtattgaaacatttaccgaaacaattttttgcttcgctt
gttcaaaaagtgcagaaaaaaatgcaggaaggggcagatgtgattaatttaggtcaagga
aatcctgatcagcccactcctccacatattgtgaaagcgatgcaggaagcggtagcaaaa
cctgaaaatcatcaatactcctcattccgcgggacagcgaaactaaaaaaggccgcagct
gctttttatgaaagagaatatggcgtcacgcttgacccaaagacagagattgccatctta
tttggaggaaaagcgggactagtcgaattgccgcaatgtttactgaatccaggtgatacg
ctgcttgttccagacccaggatatcctgattactggtcaggcgctgtgcttgccggagct
catatggtcacaatgcctcttcttgaacaaaatgattttttgcctgactaccaccaactg
tcagaagaggataagaatcaagcaaaattgatgtacttaaattacccaaataatccgact
ggtgcgactgcaacccggacattttttgaagatactgttgcgtttgcgagtgaaaataat
atgtgtgtagtccatgattttgcatatggcggcataggatttgacggcgaaaagcccctc
agtttcctgcaaatagacggagcaaaagagactggtattgaaatatatacattgtccaaa
acgtataatatggctggctggagagtcggttttgcagcagggaatgcctctgttatcgaa
gccattgagctttatcaggatcacctgtttgtgtcactgtttaaagcaactcaagatgca
gcagcagaagcacttttaagcgatcaaacgtgcgtccaactgcaaaatgatcggtacgaa
aatagacgaaacacttggattgctgcatgcaaagagattggctgggacgtcagtgcgcca
aagggctcgttttttgcttggttaaaggtgcctgaagggtatacatctgaaactttttct
gatgtattattagaaaaagcacatgttgttgttgcaccggggaatggctttggtgctcac
ggtgaaggctacgtcagagtcggtcttttaacaagtgaggagcggctaaaggaagccgct
gatcgtatcgctgccttgcagttatttgaaaaaaagccattgacaacgtaa

DBGET integrated database retrieval system