KEGG   Bacillus pumilus MTCC B6033: BW16_09750Help
Entry
BW16_09750        CDS       T03175                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bpum  Bacillus pumilus MTCC B6033
Pathway
bpum00010  Glycolysis / Gluconeogenesis
bpum00053  Ascorbate and aldarate metabolism
bpum00071  Fatty acid degradation
bpum00280  Valine, leucine and isoleucine degradation
bpum00310  Lysine degradation
bpum00330  Arginine and proline metabolism
bpum00340  Histidine metabolism
bpum00380  Tryptophan metabolism
bpum00410  beta-Alanine metabolism
bpum00561  Glycerolipid metabolism
bpum00620  Pyruvate metabolism
bpum00625  Chloroalkane and chloroalkene degradation
bpum01100  Metabolic pathways
bpum01110  Biosynthesis of secondary metabolites
bpum01120  Microbial metabolism in diverse environments
bpum01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BW16_09750
   00053 Ascorbate and aldarate metabolism
    BW16_09750
   00620 Pyruvate metabolism
    BW16_09750
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BW16_09750
   00561 Glycerolipid metabolism
    BW16_09750
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BW16_09750
   00310 Lysine degradation
    BW16_09750
   00330 Arginine and proline metabolism
    BW16_09750
   00340 Histidine metabolism
    BW16_09750
   00380 Tryptophan metabolism
    BW16_09750
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BW16_09750
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BW16_09750
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BW16_09750
Enzymes [BR:bpum01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BW16_09750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AHL71654
UniProt: W8QNI3
LinkDB All DBs
Position
1851198..1852625
Genome map
AA seq 475 aa AA seqDB search
MRNQEKHFINGEWVASTGNETTEVINPATEEVIGTISLGTKEDLDQAVKAARAAFPSFSK
TSRNERVEMLENIVRGYEKRKDELVEVMTQELGAPLKVSEEVHYKMGYEHFSKAAEALKS
YTFTEDRGGHTIIKEAIGVSGLITPWNFPTNQTSLKIAGAIAAGSPVVLKPAEITPFAAM
ILAEIIDEAGVPKGVFNLVNGTGDVIGDGISSHPDIDFVSFTGSGAVGSKIMENAADNVK
KVALELGGKSPLIVLDDADVDEAAETAIHHIAMNTGQVCSAATRVLIPESMKDKFEKALL
NALPKFTVGDPREDHATGPLVSKKQWDTVQSYIEKGIEEGATLLAGGTGKPDGIDKGYFA
KHTIFTNVKNDMTIAQEEIFGPVMSVITYQDLDHALEIANDTVYGLAGYVVGQDEKTLKF
VAEHIRAGQITINNAETDYFAPFGGFKQSGIGREWGDFGIEEYLEVKAVMGLPTA
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatcaagagaaacactttattaatggagaatgggtcgcatcaacaggaaacgaa
acgacggaggtcattaaccctgcgacagaggaagtcattggcaccattagtttaggaacg
aaagaagatttagatcaagctgtcaaagcagctcgagctgccttcccttctttctcaaaa
acatctcgaaatgaacgagtagaaatgctggaaaacattgtgcgcgggtacgaaaaacgt
aaggatgagcttgtagaagtgatgacacaagaacttggtgcaccattgaaagtgtccgaa
gaagttcattacaaaatgggttatgaacatttttctaaagcagcagaagcactgaaatct
tatacatttaccgaagaccgcggtggacatacgattataaaagaggcgattggtgtcagc
ggattgattacaccgtggaacttcccgacgaatcagacatctcttaaaattgcgggtgcc
attgcggcaggttcaccagttgtcttaaagccagcggaaattaccccttttgctgcgatg
attcttgcagaaattattgatgaagcaggtgtaccgaaaggagtcttcaacttagtaaac
ggaacgggtgacgtgattggtgacggcattagctcacatcctgatattgacttcgtttca
tttacaggatcaggtgccgtcggctctaaaattatggaaaatgcagcggacaatgtgaag
aaagtagcacttgagcttggcggaaaatcccctcttatcgtcttagacgatgcagatgtg
gacgaagcagcagaaacagccattcatcatattgcgatgaatacaggtcaagtgtgttct
gcagctacacgtgtgctgattccagaatcaatgaaagacaagtttgaaaaagcgctgctg
aacgccctgccgaagtttacagttggtgatccgagagaagatcacgctactggcccgctt
gtttctaaaaagcagtgggatacggtgcaatcttatattgaaaaaggaatcgaagaaggt
gctacccttcttgctgggggaactggaaagccagacggaatcgataaaggatatttcgcc
aagcataccattttcaccaatgtgaaaaatgatatgaccattgcgcaagaagaaatcttt
gggccagtcatgagtgtgatcacgtatcaagacctcgatcatgcccttgagatcgccaac
gatacagtgtatggtcttgccgggtatgttgttggtcaagatgaaaaaacattaaaattt
gtcgctgaacatattcgtgccggtcaaatcaccattaacaatgctgaaacagattacttt
gccccatttggcggttttaagcagtctggtatcggaagagaatggggagacttcggtatc
gaagaatatttagaagtgaaagctgtgatgggacttccaacggcgtaa

DBGET integrated database retrieval system