KEGG   Bacillus pumilus MTCC B6033: BW16_09940Help
Entry
BW16_09940        CDS       T03175                                 

Definition
(GenBank) nitrite reductase
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
bpum  Bacillus pumilus MTCC B6033
Pathway
bpum00910  Nitrogen metabolism
bpum01100  Metabolic pathways
bpum01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpum00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BW16_09940
Enzymes [BR:bpum01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     BW16_09940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Fer2_BFD NIR_SIR Pyr_redox Rubredoxin_C Pyr_redox_3 NIR_SIR_ferr NAD_binding_9 HI0933_like GIDA NAD_binding_7 K_oxygenase AlaDh_PNT_C Oxidored_nitro 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AHL71688
UniProt: W8QWS8
LinkDB All DBs
Position
complement(1897020..1899431)
Genome map
AA seq 803 aa AA seqDB search
MKEKLVLVGNGMAGIRTLENILKTDNERFDMTVFGTEPYPNYNRILLSKVLQGDTKTEDI
TLNDWNWYKEHHIQLFTNETIVKIDPDNQTVMSDQGRTVHYDRLILATGSLPFIPPIPGS
DKKGVTAFRTLQDTEEMVKASMMYKKAAVIGGGLLGLEAARGLLNLGMEVTVIHLGSHLM
DRQLDPVAGQLLQAALEKQGMSFLLGKQTNEILGDTRVEGLTFSDGSTLETDMVVMAAGI
KPNHKLAETSGIEVNRGIIVNDFMETSVPRIYAVGECVEHRGQTYGLVAPLYDQANVLAK
HVCDMAPTPYEGSVLSTQLKVSGVDVFSAGDFIENDEKKAIKIFDEQQGIYQKLVFQQNR
LVGAVMFGETSDGPRLFSYIREGVDMSDMEKVSVLTSNELAQENTIEQMANDHIVCGCNG
VSKGQIVAAIQKEGLTTIQEVKQCTSASRSCGGCQPVVEEILWHTLGDDANRTAQKETIC
ACTTLSRDEVIHEIKEKGLQHVKEVMNVLDWETEEGCSKCRPALNYYLGMMYPLDYKDEK
SSRFVNERMHANIQNDGTYSVVPRMYGGVTNANDLRKIADVVDKYEIPLVKMTGGQRIDL
LGVKKEDLPKVWADLDMPSGYAYGKSLRTVKTCVGEQFCRFGTQDSISLGIALEKKFEGL
ATPHKVKMAVSACPRNCAESGIKDLGIVGIDGGFELYAGGNGGTHLRAGDLLMKVSTAEE
VEQMAAAYLQYYRETANYLERTSAWVERLGLNHIQTVLLDDKKRAALIERMDIALSTYEE
PWQEIRENETETRQLFQKATASV
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaaactcgtattagtagggaatggtatggctggtatccgaacgctcgaaaac
attttaaaaacagacaatgaacgattcgacatgactgtatttggaactgagccgtatcct
aactataatcggattcttttatcgaaagttctccaaggggatacaaagacagaggatatt
acgttaaacgattggaattggtacaaagaacatcatattcagctgtttacaaatgagacc
attgtgaagatcgatccagacaatcaaaccgttatgagtgatcaaggacggaccgtgcat
tatgaccgtttaattttagcgacagggtccctcccgttcatcccgcccattccagggagc
gataaaaaaggggtaacagcttttcgtacattacaagacacagaggaaatggtcaaagca
tctatgatgtacaaaaaagcagccgtcattggaggcgggctccttggacttgaagccgcg
cgtggtctactaaacttaggaatggaagtgaccgtcattcatcttggctctcatctaatg
gaccggcagctcgatccggtggcaggtcagcttctgcaagcagctttagaaaaacaaggc
atgagctttctattaggaaaacagacaaatgagattttaggagatacaagggtagaaggg
ctaacattttcagatggttctacattagagacagatatggtggtcatggcagcaggaatt
aaaccgaatcacaagcttgccgaaacgagcggcattgaagtgaaccgggggattatcgtc
aatgatttcatggaaacaagtgtcccgcggatttacgcagtcggagaatgtgttgaacat
agaggacaaacgtacggtcttgttgcgccattatacgatcaagcaaacgtgcttgcgaag
catgtttgtgatatggccccgacgccttatgaaggatctgtactatcgacacagctaaaa
gtatcaggggttgatgtattttcagctggagattttatcgaaaacgatgagaaaaaagcg
attaaaatttttgatgaacagcaaggtatttatcaaaaactagtcttccagcaaaaccga
ttagtcggcgccgtcatgtttggagaaacaagcgatggaccacgtttattctcgtacatt
agagaaggtgttgatatgtcagatatggaaaaagtatctgtcttaacatcaaatgagctg
gcgcaagaaaacacgattgaacaaatggcaaacgaccatatcgtttgtggctgtaatggt
gtctcaaaaggtcaaatagtggcagctattcaaaaagaaggcctaacgactatacaagag
gtcaagcaatgtacaagtgcttctcggtcatgcggaggctgccaacctgttgtggaagag
attttatggcacactttaggcgatgatgcaaaccgcactgcgcaaaaagaaaccatctgc
gcctgcaccaccttatcaagagatgaagtgattcatgaaataaaagagaaaggtttgcag
catgtcaaagaagtgatgaatgtacttgactgggaaacagaagaaggctgttcaaagtgc
cggcctgcactgaattactatttagggatgatgtatccgcttgactacaaagatgaaaaa
agctcgcgatttgtgaatgaacgaatgcatgccaacatccaaaacgatggtacctattcg
gtcgttccacgtatgtacggaggcgtgacaaatgctaatgacctgagaaaaatagcggat
gtcgttgacaaatatgagataccgcttgtgaaaatgactggagggcagcgaatcgacctt
ttaggtgtcaaaaaagaagatttaccaaaagtatgggctgatttagatatgccgtctggt
tatgcttacggaaaatcattaagaaccgtcaaaacttgtgttggagaacaattttgcaga
ttcggaacgcaggattccatttctcttgggatcgcacttgaaaagaaatttgaaggactt
gccacaccgcacaaagtcaaaatggccgtatcagcctgtccaagaaactgtgctgaatct
gggattaaagatcttggcatcgtaggtatcgatgggggatttgaattgtatgctggcggg
aatggagggacacatttacgagctggagacttattaatgaaagtaagtacagcagaagaa
gtagaacaaatggccgcagcctaccttcaatattacagagaaaccgcaaattatttagag
agaacatccgcttgggttgaacggcttggattgaatcatatccaaacggtactgctagat
gacaagaaacgtgcagcattaatcgaaagaatggacatcgcactttcaacttatgaagaa
ccgtggcaagagattcgagagaacgaaacagaaacaagacaattatttcaaaaggcaact
gcttccgtctaa

DBGET integrated database retrieval system