KEGG   Bacillus pumilus MTCC B6033: BW16_12085Help
Entry
BW16_12085        CDS       T03175                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bpum  Bacillus pumilus MTCC B6033
Brite
Enzymes [BR:bpum01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BW16_12085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N MPTase-PolyVal
Motif
Other DBs
NCBI-ProteinID: AHL72091
UniProt: W8RJI8
LinkDB All DBs
Position
complement(2285158..2285766)
Genome map
AA seq 202 aa AA seqDB search
MAFKLPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAIEGVSALEDQSIEELVAN
LNSVPENIRTAVRNNGGGHANHSLFWTLLSPNGGGAPTGELADAIEKELGGFEKFKSDFA
AAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLTEGKTPILGLDVWEHAYYLNYQNRRPD
YISAFWNVVNWDEVARLYSEAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcttttaaacttccagaattaccatatgcttacgatgcattagaaccacatatcgac
aaggaaacaatgacgattcaccacacaaaacaccataacacttatgtaacaaacttaaac
aaagcaatcgaaggtgtatcagctcttgaagatcaatcaattgaagagctagtggctaac
ttgaactctgtgcctgaaaacattcgtacagctgtacgtaacaatggcggaggacatgcg
aaccactcattattctggacgcttctttcaccaaacggtggcggcgcaccaactggtgaa
cttgcagatgcgatcgaaaaagaattaggcggatttgaaaaattcaaatctgatttcgct
gcagcagctgcaggacgctttggttctggttgggcatggcttgttgtgaacaatggcaaa
cttgaaatcacaagcacaccaaaccaagattctcctttaactgaaggaaaaacaccaatc
ctaggactagacgtttgggagcatgcttactacctaaactaccaaaaccgtcgtcctgat
tacatttcagcattctggaatgttgtgaactgggatgaagtggctcgcctttacagcgaa
gctaaataa

DBGET integrated database retrieval system