KEGG   Bacillus pumilus MTCC B6033: BW16_13815Help
Entry
BW16_13815        CDS       T03175                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bpum  Bacillus pumilus MTCC B6033
Pathway
bpum00010  Glycolysis / Gluconeogenesis
bpum00030  Pentose phosphate pathway
bpum00051  Fructose and mannose metabolism
bpum00052  Galactose metabolism
bpum00680  Methane metabolism
bpum01100  Metabolic pathways
bpum01110  Biosynthesis of secondary metabolites
bpum01120  Microbial metabolism in diverse environments
bpum01130  Biosynthesis of antibiotics
bpum01200  Carbon metabolism
bpum01230  Biosynthesis of amino acids
bpum03018  RNA degradation
Module
bpum_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bpum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BW16_13815
   00030 Pentose phosphate pathway
    BW16_13815
   00051 Fructose and mannose metabolism
    BW16_13815
   00052 Galactose metabolism
    BW16_13815
  09102 Energy metabolism
   00680 Methane metabolism
    BW16_13815
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BW16_13815
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:bpum01009]
    BW16_13815
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:bpum03019]
    BW16_13815
Enzymes [BR:bpum01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BW16_13815
Protein phosphatases and associated proteins [BR:bpum01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BW16_13815
Messenger RNA biogenesis [BR:bpum03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BW16_13815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AHL72413
UniProt: W8QYS4
LinkDB All DBs
Position
complement(2612843..2613802)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHNVEVYGIYNGYSGLINGKIEKLEIGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIENLKKFGIEGLVVIGGDGSFMGAKKLTELGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVVEVMGRHAGDIALWS
GLAGGAESILIPEADYDMDEIIARLRRGHERGKKHSIIIVAEGVGSGVEFGKRIEEETSL
ETRVSVLGHIQRGGSPSAFDRVLASRLGAYAVELLLEGRGGRCVGIQSNELVHHDILDIL
DKKHTVDQNMYRLSQELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtataggagttttaacgagcggtggggattccccaggaatgaatgcagctgtg
cgcgcagttgtaaggaaagcaatttaccataatgtagaagtttacggtatttataatgga
tattcaggtctaattaacggtaaaattgagaaactcgaaataggttcagtaggcgatatc
attcatcgtggaggaacaaaactttacacggcaagatgtcctgaattcaagacagttgaa
ggtcgtgaaaaagggattgagaacttaaaaaaattcggtattgaaggacttgttgtcatc
ggtggagatggctcattcatgggagcgaagaaattaacagagctcggttttccatgtgta
ggtgtccctggcacgattgacaatgacattcctggtactgatttcactattggctttgat
acagcactaaatacagtcattgatgccattgataaaattcgtgatacagccacatctcat
gaacgtacatacgtagtggaagtaatgggaagacatgcaggggatattgccctttggtca
ggtcttgcaggcggagctgaatcgattttgattcctgaagcagactatgacatggacgaa
attattgccagattgagaagaggacatgagcgcggcaagaagcacagtatcatcatcgtc
gcagaaggcgtaggcagcggtgtcgaatttggtaagagaattgaagaggagacaagcctt
gaaacgcgtgtatctgtcttaggacatattcagcgtggaggttctccaagtgcgtttgac
cgagtgctcgcaagtcgcttaggagcgtatgcagtagaacttcttcttgaaggaagaggc
ggacgctgtgtaggcattcaaagcaacgaactcgttcatcacgatattttagacatctta
gataaaaagcatacagtcgatcaaaatatgtaccgactttcacaagagctctctatataa

DBGET integrated database retrieval system