KEGG   Bacillus pumilus MTCC B6033: BW16_18180
Entry
BW16_18180        CDS       T03175                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K19549  bacilysin biosynthesis transaminase BacF [EC:2.6.1.-]
Organism
bpum  Bacillus pumilus MTCC B6033
Pathway
bpum00998  Biosynthesis of various secondary metabolites - part 2
bpum01100  Metabolic pathways
bpum01110  Biosynthesis of secondary metabolites
Module
bpum_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bpum00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BW16_18180
Enzymes [BR:bpum01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     BW16_18180
SSDB
Motif
Pfam: Aminotran_1_2 Alliinase_C
Other DBs
NCBI-ProteinID: AHL73225
LinkDB
Position
3437671..3438864
AA seq 397 aa
MKMLASKMIERLPEQKFGTVFEKIAQKTKNGANIMNLGQGNPDLPTPPHIVSALQESADV
LPFQQYAPFRGFDFFKQAIADFYRSEFGAEIDPQKEIALFTGGKTGLYVMSQCLLDPGDI
ALVPDPGYPEYHSGILMADAKPYSIKLEEKNGYLPDLSSIDPDIVKKAKVLFLNYPNNPT
GAVANEAFFEEAATFADAHELYVIHDFAYGSFHYEQTPVSFMNTPLGKSVGVELYSLSKT
FNMAGWRVAFAVGNEEIIQAINTFQDHVFVSMYGGFQHAATAALQSDDCHIQSLKAIYLE
RINFFIRQAARKLGWTIERPPGAFYLWAPIPDDFEHSHAFADYLLEHADVVVTPGGVFGA
NGSRHVRISMVAPIEELALFIDRLSILPIRFHQKTRL
NT seq 1194 nt   +upstreamnt  +downstreamnt
gtgaaaatgttagcatctaaaatgattgaacggctgcctgaacagaaattcggcaccgtt
tttgaaaaaatagctcaaaagacaaaaaacggagcaaacatcatgaatctaggtcagggg
aaccctgatctaccaactcctccccatatcgtgagtgccctacaggagtcagcggatgtt
ttgccatttcaacaatatgccccttttagaggctttgactttttcaaacaagctattgca
gatttttatagatcggaattcggtgctgagattgatccgcagaaggaaattgctcttttc
actggcggaaaaacggggctgtatgtcatgagtcagtgtctgcttgatccaggagatatc
gcactcgttcccgatccaggataccctgaatatcattcaggcattttgatggcggacgcc
aagccatacagtatcaaacttgaagagaaaaatggctatttaccagatctctcctcaatt
gatcctgacatagtcaaaaaagcaaaagtactgttcttgaattatccgaataaccccacg
ggcgctgttgcaaatgaggcattctttgaagaggctgctacctttgcggacgctcacgag
ctgtatgttattcatgatttcgcctatggttcatttcattatgaacaaacacccgtgagc
ttcatgaatactcctctcgggaaaagtgtaggagtggaattatattctctatcaaagact
tttaatatggcaggatggagagtcgcttttgctgttggaaatgaggagatcatccaagcc
atcaacaccttccaagaccacgtgtttgtcagtatgtatggcggatttcaacatgcagcg
actgctgccttgcaaagtgatgactgtcatattcaatcattaaaggcgatataccttgaa
cgaatcaatttcttcatccggcaagcggcgagaaagcttggttggacaatcgaacgtcca
cccggcgccttttatttatgggctccgattcctgatgactttgaacactctcatgccttt
gctgactatttactcgaacatgccgatgttgttgtcacgcctggaggagtatttggagcc
aatggaagccgtcatgtacgtatttccatggttgccccgattgaggagcttgctctcttt
atcgatcgcctgtccatcctccccattcgatttcatcaaaaaacccgcctatag

DBGET integrated database retrieval system