KEGG   Bacillus pumilus MTCC B6033: BW16_19515Help
Entry
BW16_19515        CDS       T03175                                 

Definition
(GenBank) hypothetical protein
  KO
K06885  uncharacterized protein
Organism
bpum  Bacillus pumilus MTCC B6033
Brite
KEGG Orthology (KO) [BR:bpum00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BW16_19515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD Katanin_con80
Motif
Other DBs
NCBI-ProteinID: AHL73561
UniProt: W8RNJ6
LinkDB All DBs
Position
complement(3697744..3699261)
Genome map
AA seq 505 aa AA seqDB search
MIIVTDQLNKSILDPIHGLVRMTEDEMRIISHPLFNRLRKVKQNTFLYFVFPSANHTRFE
HSIGVMHLASEMFLNAFSNANTLKNKRIKYGLDGNGNIFDNEYFSNQEFIDVFLNLRIAA
LLHDIGHGPMSHLFDQFAPKNSDFLEMISNDTSISFNTEFASSLKELIKDKALEYVEHEF
VSYYFAAKVLSSIGFTDERIKIILTIMNEKLNLKKINIKKYNLTPFLNQIVAGAPLDCDR
MDYLLRDSYFSGVKYGTYDLNRLLKSLLPFIDKEKTKIKLGIKKSGLPAIENFLQARYEL
YVQVYYHKTNQACNTMLSHATNDLKEKGYCFVNCNTGDDFISSYLELSDEKFLDKVQREV
PDDNDKQTINELKNRKLWKRIYEYFPEDGETKEIIKNETKDIVNYITNNNLELKSFVSDS
FTSIDSLKDLNGEEAVLLNKDNDENYIETQNEWKADSKIFNALSSIYQVGRVYMRASTEN
NKERESFRNIKQDLYKYKIKNSNNN
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgataatagttactgatcaattaaataaaagtatattagatccaatacatggactagta
agaatgactgaagatgaaatgagaattatttcacatccgctttttaataggttgagaaaa
gttaaacagaatacctttttatattttgtatttccttctgcaaatcatacaagatttgaa
cattctattggtgtaatgcacttagcaagtgagatgtttttaaatgcattcagtaatgct
aataccttgaaaaataagagaataaaatacggtcttgatgggaatggaaatatctttgat
aatgaatacttttctaatcaagaatttatagatgtgtttttaaatttacgtattgcagca
ctcttacatgatatagggcatggaccaatgtctcatttatttgatcaattcgcaccaaaa
aactctgactttttagaaatgatttcgaacgatacaagtattagttttaatactgaattc
gctagttcattaaaagagttaataaaagacaaagcattagaatatgttgaacatgaattt
gtatcttattattttgctgcaaaggttttatcaagtataggatttactgacgaacgtatt
aaaattattttaactattatgaatgaaaagcttaatctaaagaaaattaatataaaaaaa
tataatcttacaccatttcttaaccaaattgtagctggtgcacctttagattgtgacaga
atggattatttattaagagatagttattttagtggggtaaagtatgggacttatgatctc
aacagattattaaaatctttattgccgtttattgataaggaaaaaacaaagataaagttg
ggcattaaaaaaagcggattacctgcaatagaaaatttccttcaagcaaggtatgaactt
tatgttcaagtttattaccataagacaaatcaagcgtgtaataccatgttatctcatgct
acaaatgatttaaaagaaaagggatattgctttgttaattgtaatactggcgatgatttt
atatcttcgtacttggaactttcagatgagaagtttttagataaggtacaaagagaagtt
ccagatgataatgataaacaaacaataaatgaattaaaaaatcggaaactttggaagaga
atatacgaatatttcccagaagatggagaaactaaagaaattataaaaaatgaaactaaa
gatatagttaattatataactaataataatttggaattaaaatcttttgtctcagatagt
tttacttcaattgattcattaaaagatttaaatggagaagaagcggtattgcttaataaa
gataatgatgaaaattatatagagactcaaaatgagtggaaagctgattctaagatattc
aatgcattatctagtatatatcaagtaggaagagtatatatgcgtgcatcaactgaaaat
aataaggaaagggagtctttcagaaatataaaacaagatttatataaatataaaattaaa
aacagtaataataattaa

DBGET integrated database retrieval system