KEGG   Bacillus pumilus SH-B9: UP12_02485Help
Entry
UP12_02485        CDS       T04776                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bpus  Bacillus pumilus SH-B9
Pathway
bpus00473  D-Alanine metabolism
bpus00550  Peptidoglycan biosynthesis
bpus01100  Metabolic pathways
bpus01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bpus00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    UP12_02485 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    UP12_02485 (ddl)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    UP12_02485 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bpus01011]
    UP12_02485 (ddl)
Enzymes [BR:bpus01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     UP12_02485 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:bpus01011]
 Precursor biosynthesis
  Amino acid ligase
   UP12_02485 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST GARS_A
Motif
Other DBs
NCBI-ProteinID: AMM96286
LinkDB All DBs
Position
521070..522152
Genome map
AA seq 360 aa AA seqDB search
MKISLGLIYGGKSAEHNVSLQTALAVTKALNTEKFDIHPIYITEEGEWLRGEKLTEPVSN
VRMLQFEQNAKAFLPTSLNESMFPQPASADEKIDVVFPLLHGPNGEDGTMQGLLELLNIP
YVGNGVLASAAGMDKVMMKDVFAQAGLAQAKHLSFNKKDYEKATPDSLEQVEQVLGYPCF
VKPANMGSSVGISKCRSKEELQTAFDLAFQYDRRVVVEEGVVGREIEIGVLGNDEPKCSV
VGEIAPKTDFYDYKAKYEDGDTDLIIPASVSEDEYKTIHDMAIKAFKSLDGSGLVRADFF
LTEKGEVLINEVNTMPGFTPFSMFPLLWKHTGVEYPELIEKLVSLAIERHQEKQTIKTTF
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaataagtttaggattgatttacggcggaaagtcagccgaacataatgtatcactg
caaacagcccttgcagttacaaaagcacttaacactgagaagttcgatatacatccaatt
tatattacagaagagggcgaatggctaagaggagaaaaactcactgaaccagtatcaaac
gtcagaatgcttcaatttgaacagaatgctaaggcgtttttaccaacttctttaaatgag
agcatgtttccacagcctgcatccgctgatgagaagattgatgttgtcttcccattattg
cacgggccaaatggtgaagatggaacgatgcaaggattacttgaactgctaaatatccca
tatgtcggcaacggcgttcttgcttctgccgcgggtatggataaagtcatgatgaaagat
gtttttgctcaagcaggacttgcacaagcgaagcacctttcctttaataaaaaagactat
gagaaagccacaccagacagcttagaacaggtagaacaagtacttggctatccatgcttt
gtgaaacctgccaacatgggatcaagtgttggaataagcaaatgccgcagcaaagaagag
ctgcaaaccgcattcgacttagctttccaatatgatcgtcgtgtggtcgtagaagaaggc
gtcgtaggaagagaaatcgagattggtgtattaggaaatgacgagccgaaatgctctgtc
gttggtgaaattgcacctaaaacagatttttatgactacaaagcaaaatatgaagatggc
gatacagatttgatcattcctgcaagtgtgtcagaggatgaatacaagacgattcatgat
atggcgattaaggcatttaaatcccttgatggttcgggtcttgtacgtgcagacttcttc
ctcacagaaaaaggtgaagtgttgatcaatgaagtgaatacaatgcctggattcacacca
ttcagtatgttcccgctgctttggaagcacactggtgtagagtatccagagctcattgaa
aagctagtgtcacttgcaattgaacgccatcaagaaaaacaaaccattaaaacgactttt
taa

DBGET integrated database retrieval system