KEGG   Bacillus pumilus SH-B9: UP12_02535Help
Entry
UP12_02535        CDS       T04776                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bpus  Bacillus pumilus SH-B9
Pathway
bpus00473  D-Alanine metabolism
bpus01100  Metabolic pathways
bpus01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bpus00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    UP12_02535
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    UP12_02535
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bpus01011]
    UP12_02535
Enzymes [BR:bpus01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     UP12_02535
Peptidoglycan biosynthesis and degradation proteins [BR:bpus01011]
 Precursor biosynthesis
  Racemase
   UP12_02535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C BTB_2 DUF1796
Motif
Other DBs
NCBI-ProteinID: AMM96296
LinkDB All DBs
Position
530957..532117
Genome map
AA seq 386 aa AA seqDB search
MDTNAFYRDTWAEINLSAIKHNVSHMKDHIGQSVQLMAVVKANAYGHGDIEVARAALKAG
ADVLAVAFLDEAVSLRNKGIKAPILVLGAVPPEYVKVAVRYNVIMTAYSIDWLRDVTNMM
KGQMGQPIRFHLKIDSGMNRLGVKTIEQVNEVKKLVSEHSYLQLEGVFTHFATADEKDEA
YFDRQVDTFQTLLEPLHTDKLLVHCANSAAGLRFKDVLFNMVRFGISMYGLSPSEEIKDE
LPFKLEEAMSLHTKLAHVKHIQKGESVSYGATYTANQDTWIGTVPVGYADGWIRKLAGTE
VLVGGKRRKIAGRVCMDQFMVELKDKLPVGEPVVLIGKQGEDMIPVDEIAKRLETINYEV
TCSIGHRVPRVYIEDGKRVHVRNPLL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggacacaaatgccttttatagagacacatgggcagaaattaatttatcagcgatcaag
cataatgtttcacatatgaaagatcatatcggtcaaagtgttcaactaatggctgtggtg
aaagccaatgcatatggacatggagatatagaagtggcaagagctgctctcaaagcaggt
gcagacgtattagccgtcgcctttttagatgaggccgtttctttaagaaataaaggcatc
aaagcaccaatactggtactcggcgctgtaccgccggaatatgtcaaagtcgccgttcga
tacaatgtcatcatgactgcatactccatcgattggctgagagacgtcaccaacatgatg
aaagggcagatgggacagcctatacgatttcatttgaaaatagacagcggaatgaacaga
ttaggtgtgaaaacgattgagcaagtgaacgaagtgaaaaagcttgtcagcgagcactct
tatttacagctggaaggcgtatttactcactttgcgacagcagatgaaaaggatgaggcc
tactttgatcggcaggtcgacacctttcaaacactgcttgagccgcttcatacggacaag
ctgctcgttcattgcgccaacagtgcagcaggtctaaggtttaaagacgtcttgtttaat
atggttcgcttcggcatcagtatgtacgggctgtcgccgtcagaagaaatcaaggatgaa
ctgcctttcaagctcgaagaagctatgtctcttcatacaaaacttgcccatgtgaagcac
attcaaaagggtgagagtgtcagctacggggcaacgtatacagccaatcaagatacgtgg
atcggcacggttccagttggctatgcagatggatggatccggaagctggcaggaacggaa
gtacttgttggcggaaagcgccggaagatcgccggaagggtttgtatggatcaattcatg
gttgaactgaaagacaagcttccagtaggggagccggtcgttttaattggtaagcaagga
gaagacatgataccagtcgatgaaatcgccaaaaggcttgaaaccattaactatgaagtc
acgtgctcgattggccaccgtgttccaagggtatatatagaagacggcaaaagagtgcat
gtacggaacccgctcctctaa

DBGET integrated database retrieval system