KEGG   Bacillus pumilus SH-B9: UP12_13080Help
Entry
UP12_13080        CDS       T04776                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bpus  Bacillus pumilus SH-B9
Pathway
bpus00020  Citrate cycle (TCA cycle)
bpus00480  Glutathione metabolism
bpus01100  Metabolic pathways
bpus01110  Biosynthesis of secondary metabolites
bpus01120  Microbial metabolism in diverse environments
bpus01130  Biosynthesis of antibiotics
bpus01200  Carbon metabolism
bpus01210  2-Oxocarboxylic acid metabolism
bpus01230  Biosynthesis of amino acids
Module
bpus_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpus_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bpus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UP12_13080
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    UP12_13080
Enzymes [BR:bpus01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     UP12_13080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AMM98235
LinkDB All DBs
Position
complement(2613018..2614289)
Genome map
AA seq 423 aa AA seqDB search
MSQGEKITVTGGVLNVPNNPIIPFIEGDGIGPDIWKAASRVLEAAVEKAYKGEKQITWKE
VYAGEKAYNKTGEWLPEQTLEDIREYLIAIKGPLTTPIGGGIRSLNVALRQELDLFTCLR
PVRWFKGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGSDEVKKLIDFLKNELGVNKIR
FPETSGIGIKPVSEEGTSRLVRAAIQYAIDQGRKSVTLVHKGNIMKFTEGAFKNWGYEVA
EKEFGDKVFTWAQYDRIVEQDGKDAANKAQSEAEAAGKIIVKDSIADIFLQQILTRPAEF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVLLSGVLLLEHLGWQEAADLVIQSVENTIASKVVTYDFARLMDGATEVKCSEFADELIK
NLS
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
ttgtcacaaggcgaaaaaattacagttactggcggcgtattgaatgtaccaaataatcca
atcatcccgtttatcgaaggggacggaatcggtcctgacatttggaaagcagcatcaaga
gtacttgaagcagctgtagaaaaagcatataaaggagaaaagcaaatcacttggaaagaa
gtatatgccggtgagaaagcttacaataaaactggagaatggcttcctgagcaaacactt
gaagacattcgtgaatacttaatcgcgatcaaaggaccactgacaacaccaatcggcgga
ggaatccgttcattaaacgtggcacttagacaagagcttgatctattcacatgcttacgt
ccagttcgctggttcaaaggcgtaccgtctcctgtgaaacgtccagaagacacagatatg
gtcatcttccgtgagaatacagaagatatctatgctggcatcgagtatgcaaaaggatca
gacgaagtgaagaagttaattgacttcttgaaaaacgaattaggtgttaacaaaatccgt
ttcccagaaacatcaggtatcggaatcaagccagtttctgaagaaggaacttctcgcctt
gtcagagcggctatccaatatgcaattgaccaaggccgtaagtctgtgacgcttgttcac
aaaggaaacatcatgaaatttacagaaggtgccttcaaaaactggggctacgaagtggct
gaaaaagagtttggcgacaaggtctttacatgggcacaatatgatcgtattgtagaacaa
gatggaaaagatgcggcaaacaaagcgcaaagtgaagcagaagctgctggcaaaattatt
gtcaaagacagcattgcagatattttccttcaacaaatcctaactcgtccagctgagttc
gatgttgttgcaacaatgaacttaaacggagattacatctctgatgctcttgcagcacaa
gttggtggaattggtattgcaccaggtgcgaacatcaactacgaaacaggacacgctatt
tttgaagcgactcacggaacagcacctaaatatgctggtcttgataaagtgaacccatct
tctgttcttctatcaggcgtgcttttacttgagcacctaggctggcaggaagcagctgat
ctagtgattcaatctgttgaaaatacaattgcatcaaaagtcgtcacttacgattttgct
agattaatggatggcgcaacagaagtgaaatgttctgagtttgctgacgagctcatcaaa
aacttgtcttga

DBGET integrated database retrieval system