KEGG   Bacillus pumilus SH-B9: UP12_13110Help
Entry
UP12_13110        CDS       T04776                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bpus  Bacillus pumilus SH-B9
Pathway
bpus00010  Glycolysis / Gluconeogenesis
bpus00030  Pentose phosphate pathway
bpus00051  Fructose and mannose metabolism
bpus00052  Galactose metabolism
bpus00680  Methane metabolism
bpus01100  Metabolic pathways
bpus01110  Biosynthesis of secondary metabolites
bpus01120  Microbial metabolism in diverse environments
bpus01130  Biosynthesis of antibiotics
bpus01200  Carbon metabolism
bpus01230  Biosynthesis of amino acids
bpus03018  RNA degradation
Module
bpus_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bpus_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bpus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UP12_13110
   00030 Pentose phosphate pathway
    UP12_13110
   00051 Fructose and mannose metabolism
    UP12_13110
   00052 Galactose metabolism
    UP12_13110
  09102 Energy metabolism
   00680 Methane metabolism
    UP12_13110
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    UP12_13110
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:bpus01009]
    UP12_13110
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:bpus03019]
    UP12_13110
Enzymes [BR:bpus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     UP12_13110
Protein phosphatases and associated proteins [BR:bpus01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     UP12_13110
Messenger RNA biogenesis [BR:bpus03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     UP12_13110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AMM99480
LinkDB All DBs
Position
complement(2619921..2620880)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHNVEVYGIYNGYSGLINGKIEKLEIGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIENLKKFGIEGLVVIGGDGSFMGAKKLTELGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVVEVMGRHAGDIALWS
GLAGGAESILIPEADYDMDEIIARLRRGHERGKKHSIIIVAEGVGSGVEFGKRIEEETSL
ETRVSVLGHIQRGGSPSAFDRVLASRLGAYAVELLLEGKGGRCVGIQSNDLVHHDILDIL
DKKHTVDQNMYRLSQELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtataggagttttaacgagcggtggggattccccaggaatgaatgcagctgtg
cgcgcagttgtaaggaaagcgatttaccataatgttgaagtttacggtatttataatgga
tattcaggtctaattaacggtaaaattgagaaacttgaaataggttcagttggcgatatt
attcatcgtggaggaacaaaactttacacggcaagatgccctgaattcaagacagttgaa
ggtcgtgaaaaaggcattgaaaacttaaaaaaattcggtattgaaggacttgttgtgatc
ggcggagacggttcattcatgggagcaaagaaattaactgagcttggttttccatgtgta
ggtgtcccgggtacaatcgacaacgatattccaggtactgatttcactattggctttgat
acagcactgaatacagtcattgacgccattgataaaattcgtgatacagccacatctcat
gaacgtacatacgtagtggaagtaatgggaagacatgctggtgatattgctctttggtca
ggtcttgcaggcggagccgaatctattttgattccagaagcagactatgacatggatgaa
attatcgcgaggttaagaagagggcacgagcgcggcaagaagcacagtatcatcatcgtc
gcagaaggcgtaggcagcggtgttgaatttggtaagcggattgaagaggagacaagcctt
gaaacccgtgtatctgtcttaggacatattcagcgcggaggttctccaagtgcgtttgac
cgagtactcgcaagccgtttaggagcatatgcagtagaacttcttcttgaaggaaaaggc
ggacgctgtgtgggtattcaaagcaacgacctcgttcaccacgatattttagatatctta
gataaaaaacatacagtcgatcaaaacatgtaccgactttcacaagagctctctatataa

DBGET integrated database retrieval system