KEGG   Brucella pinnipedialis 6/566: DK65_1168Help
Entry
DK65_1168         CDS       T03261                                 

Gene name
acoD
Definition
(GenBank) acetaldehyde dehydrogenase 2
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bpv  Brucella pinnipedialis 6/566
Pathway
bpv00010  Glycolysis / Gluconeogenesis
bpv00620  Pyruvate metabolism
bpv01100  Metabolic pathways
bpv01110  Biosynthesis of secondary metabolites
bpv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DK65_1168 (acoD)
   00620 Pyruvate metabolism
    DK65_1168 (acoD)
Enzymes [BR:bpv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     DK65_1168 (acoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIJ74801
LinkDB All DBs
Position
1:complement(1157811..1159328)
Genome map
AA seq 505 aa AA seqDB search
MNKVEFSRTVKPAFAKRYGNFIGGKWVEPRSGRYFENTSPVNGQVLCEVARSDAADVEAA
LDAAHAARELWGRTSVAERALILNRIADRIEENLPALAAAETWDNGKPIRETTNADLPLA
VDHFRYFAGVIRAQEGGISEIDHDTVAYHFHEPLGVVGQIIPWNFPLLMATWKLAPALAA
GNCVVLKPAEQTPASILVLMELIADILPPGVVNIVNGFGLEAGKPLASSPRIAKIAFTGE
TTTGRLIMQYASQNLIPVTLELGGKSPNIFFKDVAAEDDDFLDKAIEGFVMFALNQGEVC
TCPSRALIQESIYDRFMEKALKRVEAIVQGDPLDPATMIGAQASSEQLEKILSYLGIGRQ
EGAEVLAGGERNMLPGDLAGGYYVKPTVFKGHNKMRIFQEEIFGPVVSVATFKDDAEALS
IANDTLYGLGAGIWTRDGTRAYRFGRAIKAGRVWTNCYHAYPAHAAFGGYKQSGIGRENH
LKMLDHYQNTKNMLVSYSPKKLGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggttgaattcagccggaccgtgaaaccggcttttgcaaaacgctatggcaat
ttcatcggcggcaaatgggtggaacccaggtcaggccgctattttgagaatacatcgccc
gtaaacggccaggttctgtgtgaagtggcccgttccgatgctgccgatgtggaagcggcg
ctcgatgcagcgcacgccgccagggagctatggggcaggacaagcgtggctgaacgcgcg
cttatcctcaatcgcatcgcagaccggattgaggaaaacctgcctgcattggcggctgcc
gaaacatgggacaacggcaagccgatccgcgaaaccaccaatgccgacctgccgctggcg
gttgatcatttccgctatttcgcgggcgtcatccgcgctcaggaaggcggtatttctgaa
atcgatcacgatacggtcgcctatcacttccacgaaccgctgggcgtggtggggcagatc
attccgtggaacttcccgcttctcatggcgacatggaagcttgcgccagcccttgccgca
ggcaattgcgtggtgctgaaacccgccgaacaaactccggcttccatcctcgtgctgatg
gagctcattgccgatattctgccgccgggtgtggtcaatatcgtcaatggtttcggcctt
gaggccggtaagccgctggcatccagcccccgcatcgccaagatcgccttcacgggtgag
acgacgaccggccgcctcatcatgcaatatgccagccagaacctcatcccggtcacgctg
gagctgggcggcaagtcacccaacatcttcttcaaggatgtcgcggctgaagatgatgat
tttctggacaaggccattgaaggcttcgtgatgttcgcgctcaatcagggcgaggtctgt
acttgccccagccgcgcgctcattcaggaatcgatctatgacaggttcatggaaaaggcg
ctgaagcgtgttgaagccatcgtgcagggcgatccgcttgacccggccacgatgattggc
gcgcaggcatcgagcgaacaactcgaaaaaatcctgagctatctcggtattggccgtcag
gaaggtgcggaagtgctggcaggtggcgaacgcaacatgctgccgggcgatcttgctggc
ggctattatgtgaagccgaccgtcttcaagggccataacaagatgcgcattttccaggag
gaaatcttcgggccggtcgtgtccgtcgcaaccttcaaggatgatgcggaggcgctatcg
attgccaatgacacactctatggcctcggtgcgggcatatggacgcgcgatggcacacgc
gcctatcgcttcggtcgcgccattaaggcaggccgcgtctggaccaactgctaccacgcc
tacccggcccatgcggctttcggtggttacaagcagtcggggatcgggcgcgagaaccat
ctgaagatgctcgatcactaccagaataccaagaacatgctggtgagctacagcccgaag
aagcttggcttcttctaa

DBGET integrated database retrieval system