KEGG   Brucella pinnipedialis 6/566: DK65_1170Help
Entry
DK65_1170         CDS       T03261                                 

Definition
(GenBank) FAD binding domain protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bpv  Brucella pinnipedialis 6/566
Pathway
bpv00564  Glycerophospholipid metabolism
bpv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DK65_1170
Enzymes [BR:bpv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DK65_1170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AIJ73259
LinkDB All DBs
Position
1:complement(1160664..1162175)
Genome map
AA seq 503 aa AA seqDB search
MVQEKQFDIFIIGGGINGCGIARDAVGRGFTVGLAEMNDLASGTSSRATKLIHGGLRYLE
HYEFRLVREALMEREVLWANAPHIIHPMRFVLPYHKGGLRPAWLLRLGLFLYDHLGGRKK
LPATRTLNMRTDKAGEPLKPLFTKAFEYSDCWVDDARFVALTARDAADRGAKIATRTSVV
AASRDGQGWTITLEDTGTGRRENVHARLLVNAAGPWADKVLQGVEGDRQLHNIRLVQGSH
IVVRRKFSDPRAYFFQNNDGRIIFAIPYEDDFTLIGTTDQDYKGDPAKVAITDSETDYLC
QAASEYFREPVRREDIVWTYSGVRPLYDDGASKAQEATRDYVLKEDAPDGLAPLINVFGG
KLTTARKLAEHMLQKIEHRLGRKGAPWTHAAPLPGGDFEDVAFETELKKLEAAYPFLDAR
HARRLFRLYGTRAYKLLGQASSLGDLGRHFGSDLYEAEVRYLVENEWARSAEDILWRRTK
LGLRLTAAEVAAVQGFVEPAIAA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaggaaaaacaattcgatatttttattataggtggcggcatcaatggctgcggc
attgcccgtgatgcggtggggcggggcttcaccgttgggctggccgagatgaacgatctg
gcaagcggcacctcttcgcgcgcaaccaagctcattcacggtggtttgcgctatctggaa
cattatgaattccggctggtgcgcgaggcgctgatggagcgcgaggtgctgtgggccaat
gcgccgcatatcatccatccgatgcgtttcgtgctgccttatcataagggcggcctacgt
cccgcctggctgttgcggcttggcctgtttctttacgaccatctgggcggccgcaagaag
cttcccgccacgcgcacgctcaacatgcgcaccgacaaggccggcgaaccgctgaaaccg
cttttcaccaaggcttttgaatattccgattgctgggtggacgatgcgcgcttcgtggcg
ctcaccgcccgcgatgcggctgatcgcggcgcgaagatcgcgacccgaacgagcgtcgtt
gccgcaagccgcgacgggcagggctggaccatcacactggaagataccggcaccggcagg
cgtgagaacgtacacgcccgccttctggtcaatgccgccgggccgtgggccgacaaggtt
ctgcaaggtgtggaaggcgaccggcaattgcacaatatccgtctggtgcagggcagccat
atcgtcgtgcgcaggaagttttccgacccgcgcgcctatttcttccagaacaacgacggg
cgcatcatcttcgccattccttatgaagatgatttcaccctgattggcaccacggatcag
gattataagggcgacccggccaaggtggcgatcaccgacagcgagaccgattatctctgc
caggcggcaagcgaatatttccgcgagccggtgcgccgggaggatatcgtctggacctat
tccggcgtgcgcccgctctatgatgacggggccagcaaggcgcaggaggcaacccgcgac
tatgtgctgaaggaagatgcgccagatggtctggcgccgctcatcaatgttttcggcggc
aagctcaccacagcacgcaagcttgccgaacatatgctgcagaaaatcgagcaccggctt
ggccgcaagggcgccccatggacccatgcagcaccattgccaggcggggatttcgaggat
gtggcttttgaaacggaactgaagaagcttgaggcagcctatcctttccttgatgcgcgc
catgcgcgccgcctgttccggctctatggcacccgggcatataagcttttggggcaggct
tcttcgctgggcgatcttggccgtcattttggcagcgatctctatgaggcggaagtgcgc
tatcttgtcgaaaatgaatgggcgcgaagcgcggaagacattttgtggcggcgcaccaag
ctcggcctgcgcctgacggcggcggaagtcgcggccgtgcagggctttgtggagcctgca
atcgccgcctaa

DBGET integrated database retrieval system