KEGG   Brucella pinnipedialis 6/566: DK65_1552Help
Entry
DK65_1552         CDS       T03261                                 

Definition
(GenBank) virulence factor BrkB family protein
  KO
K07058  membrane protein
Organism
bpv  Brucella pinnipedialis 6/566
Brite
KEGG Orthology (KO) [BR:bpv00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    DK65_1552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB DUF4141
Motif
Other DBs
NCBI-ProteinID: AIJ73725
LinkDB All DBs
Position
1:complement(1574169..1575029)
Genome map
AA seq 286 aa AA seqDB search
MQKIRRFLRQITFDVWGHFSTDDGWAFASHIALSGLMALFPFLIFATSLASFLGTREFAN
TAVHVIFDMWPSNIAAPIANEVKSVLTVQRRGLLTVSVIAAAYFASNGVEALRIALNRAY
RVTDQRSIIFCRLQSLGFVLVGTLSLMAISFLLVLAPLAVRIAEQWFPDIAPFTGTIAFW
RYTIAVAVLVLALFMVHIWLPAGRRGLGDILPGIVITLIAWLAAATAFAKYLETFANYVS
TYAGLASIMVAIVFLYMLSAIFIVGAEINAAIMIFRKREQQPNLNL
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaatcagacgttttctccgtcagatcaccttcgatgtatggggacatttcagc
accgacgacggctgggcttttgccagccacattgccctttcgggcctgatggcgctgttt
ccatttctgattttcgccacctcgcttgcaagctttctgggcaccagggaattcgccaac
acggcagtacacgtcattttcgacatgtggccctcgaatatcgcagcccccattgccaat
gaagtgaaaagcgtcctgaccgtgcagcgccgcgggcttttgaccgtcagcgtgatcgcc
gccgcttatttcgcctccaatggcgtggaggcgctgcgcattgcgctcaaccgcgcctac
cgcgtgaccgaccagcgatcgatcatcttctgccgcctgcaaagcctcggtttcgtgctg
gtcggcacattgagcctgatggcgatcagctttcttctggttctggcgccgcttgccgtg
cgcattgccgaacaatggttccccgatattgcgccctttaccggcacaatcgccttctgg
cgctatacgattgccgtcgctgttctggttctggcgcttttcatggtgcatatctggctg
cccgccgggcggcgcggccttggcgatatcctgccgggcatcgtcatcacgctcatcgca
tggcttgccgccgccaccgctttcgcaaaatatctggaaaccttcgccaattacgtctcc
acctatgcgggcctggcctcgatcatggtggcgattgtctttctctacatgctgtcggca
attttcattgtcggtgcggaaataaatgccgcaatcatgatttttcgcaagcgtgagcag
caaccgaacctcaacctgtaa

DBGET integrated database retrieval system