KEGG   Brachyspira pilosicoli WesB: WESB_0265Help
Entry
WESB_0265         CDS       T02412                                 

Definition
(GenBank) AP endonuclease
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
bpw  Brachyspira pilosicoli WesB
Pathway
bpw00040  Pentose and glucuronate interconversions
bpw00051  Fructose and mannose metabolism
bpw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    WESB_0265
   00051 Fructose and mannose metabolism
    WESB_0265
Enzymes [BR:bpw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     WESB_0265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: CCG55737
UniProt: K0JG80
LinkDB All DBs
Position
complement(277138..278058)
Genome map
AA seq 306 aa AA seqDB search
MNFAGRINSLKGKMQDLSIAIEKLKKIKGITHIDLNYPEHFSNNDISEIKKSMGGLKLNG
ISTRFKEEFIHGEFINKDKKIRQNAIDLCKRAIDICQELDGEYLTIWCAYDGFDYPFQID
YERSWNNTISALQEISDYSKKVKISFEYKPYEPRAFSLLDSIGHVLTAISDTKRDNIGVT
LDFCHMIMKKENPAYSLALAAMRNKLYGLHMNDGYGSIDNGLIFGSISLSQALEFVYYLI
KYKYDGVVFFDSFPVREDASKEIESNINIFNKMVEIINSLGEKHIEEMISHQDAIEVSNM
LIKILK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgctggaagaattaattcattaaaaggtaaaatgcaagatttatctatagct
atagaaaaattaaaaaagataaaagggataactcatatagatttgaactatcctgaacat
ttttctaacaatgatatatcagaaataaagaagagtatgggcggacttaaattaaatggt
atttctactagatttaaagaagaatttatacatggggaattcataaataaagataaaaag
ataagacaaaatgctatagatttatgcaaaagggctatagatatatgtcaggaactagat
ggagaatatttaactatatggtgtgcttatgatggttttgattatccttttcaaatagat
tatgaaagaagctggaataacacaatatctgctttgcaagaaatttcagattattctaaa
aaagtaaagataagttttgaatacaagccatatgaacctagagctttttcattattagat
agtataggtcatgtattaactgctatttcagatacaaaaagagataacataggtgtaact
ttagatttttgtcatatgataatgaaaaaagagaatccggcttattcattagctttagct
gctatgaggaataaattatatggtttgcatatgaatgatggatatggaagtatagataat
ggattaatatttggttctataagtttaagtcaggcattagaatttgtatattatttgatt
aaatataagtatgatggtgttgtattttttgattcttttccggtgagagaggatgcttct
aaagagatagaatccaatattaatatatttaataagatggtagaaataattaattcttta
ggagaaaaacatatagaagaaatgatatctcatcaagatgctatagaagtttcaaatatg
cttataaaaattttaaaataa

DBGET integrated database retrieval system