KEGG   Brachyspira pilosicoli WesB: WESB_1141Help
Entry
WESB_1141         CDS       T02412                                 

Definition
(GenBank) alpha glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
bpw  Brachyspira pilosicoli WesB
Pathway
bpw00500  Starch and sucrose metabolism
bpw01100  Metabolic pathways
bpw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    WESB_1141
Enzymes [BR:bpw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     WESB_1141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: CCG56610
UniProt: K0JJZ0
LinkDB All DBs
Position
1239977..1242541
Genome map
AA seq 854 aa AA seqDB search
MKVSKYMVSPSVPKELEPLMEITKNFWWVWNQKAINLLRNIDIDNWDKKDHNPIRLLGES
SQECFDTMLHDDAAMMNLAEVYDEFKTYMNQETWYDSLDDSQKTKNEKIAYFSFEYGLHE
SLPNYSGGLGILSGDHLKSASDLGLPFVAVGLLYRKGYFRQYLNADGWQQEYDIENDFFN
LALEKVLDKNGETMKVDVDLPGRKVYAQIWKANVGRIELYYLDANIEENSVEDRDITAQL
YGGNLETRIQQEILLGIGGIKALNKLGIKPTIYHMNEGHSAFLSLERMRQLMENNHLDKN
AAREVVYSSNVFTTHTPVPAGNDVFPIDMVQKYFSEYVKHIGMSMDEFLRLGRINPDDNK
ENFCMTVLALNLSSENNGVSLLHGHVSRAMWKDIWKGVPEDELPIDAITNGIHTLSWISF
DMQNLLDRYLGPRWRTKPLEHEVWERVQRIPDAELWKTHERRKERLIDFCRTRLKSQITN
RGFTKNEIEHADQILSPDALTIGFARRFATYKRGTLLFRDLDRLKKILSNKDKPVQIIFA
GKAHPHDNGGKELIREISEICRREDFRDHIVFLEDYDINVARYMVQGVDVWLNNPRRPLE
ASGTSGMKVPPNGGLNFSVLDGWWDEAYDAQNGWAIGNREQYSDLEYQDDVESKAIYNVL
ENEIIPLYYNNRGRDDIPREWVAAMKWSMQTVCPVFSTNRMVADYYNKFYNKASKRYLHM
IKNDFEKPKALKEWKQNIYDKWSKVSFENTISEMPSRNLKVGSKFEIKTIVNLGDIAPDS
VRVELYYGKLSMKEEIIEPSIIEMKHSADLGNGRHSFSGALVCNNSGQSGFAIRMYPYNK
DLSYKFDMKLIIWS
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagtaaatacatggtttcaccttctgtgccaaaagagttagaaccattgatg
gagataactaaaaacttttggtgggtttggaatcagaaagcaattaatttgttgaggaac
atagatattgacaactgggataaaaaagaccataatcctataagacttttaggggaatct
tcacaagaatgtttcgatactatgcttcatgatgatgcagctatgatgaacttagctgaa
gtttatgatgagtttaagacatatatgaatcaagaaacttggtatgatagtttagatgat
tctcaaaaaactaaaaatgaaaagattgcgtatttttcttttgaatatggattgcatgaa
tctttgccgaattattccggcggtttaggaatattatctggagaccatttgaagtctgct
agtgatttaggtttgccttttgttgctgttggacttttatatagaaaaggttattttaga
cagtatttaaatgctgatggttggcagcaggaatatgatatagaaaatgacttttttaat
ttagcattagaaaaggttttagataaaaacggcgagacaatgaaagttgatgttgatttg
cctggaagaaaagtttatgctcaaatttggaaggctaatgttggaagaatagagctttat
tatttagatgctaatatagaagaaaatagtgtagaagacagagatattacagctcagctt
tacggcggtaatttagagactagaatacagcaagagatacttcttggtattggcggtatt
aaggcattaaacaaacttggtattaagcctactatttatcatatgaatgaaggacatagt
gcttttctttctttagagagaatgagacagcttatggaaaataatcatcttgataagaat
gcggcaagagaggttgtttatagttctaacgtatttacaacacatacacctgtacctgct
ggtaacgacgtatttcctatagatatggtacagaaatatttcagcgagtatgttaagcat
attggcatgtctatggacgagttcttaagacttggaagaattaaccctgatgacaataaa
gaaaatttctgtatgacagttttagcacttaatttatcttctgaaaataacggtgtaagc
ttgcttcatggtcatgtttcaagagctatgtggaaagatatatggaaaggagttccagaa
gatgagcttcctattgatgctattactaatggtattcatacattaagctggatttctttt
gatatgcaaaacttattagatagatatttaggtcctcgttggagaactaagcctttagag
catgaggtttgggaaagagtacaaagaatacctgatgctgaactttggaaaactcatgag
agaagaaaagagagattaattgatttctgcagaactagattaaaatctcaaattacaaat
agaggctttacaaaaaatgaaatagagcatgctgaccaaatattgtcacctgatgcttta
actattggtttcgctaggagatttgctacatataaaagaggaactttattatttagagat
ttagatagattaaagaagatattgagtaataaagataaaccagtacagataatatttgct
ggtaaggcacaccctcatgataatggcggtaaagagcttattagagagatatctgaaatt
tgcagaagagaagattttagagatcatatagtatttttagaagactatgatattaatgta
gcaagatatatggttcagggtgtagatgtatggcttaataacccaagaagacctttagaa
gctagcggtacaagcggcatgaaagttccgcctaatggtggtttgaatttcagtgtatta
gatggttggtgggacgaagcttatgatgctcaaaatggttgggctattggtaatagagag
cagtattcagatttagagtatcaagacgatgttgaaagtaaagctatatataatgtctta
gaaaatgagattattcctctttattataataacagaggaagagatgatatacctcgtgaa
tgggttgctgctatgaaatggagtatgcaaactgtttgtcctgtgttctctacaaataga
atggttgctgattattataataagttctataataaagcaagcaaaagatatttgcatatg
attaaaaatgactttgaaaagcctaaagcattaaaagaatggaagcaaaatatatatgat
aaatggtctaaggtttcttttgaaaatactatttctgagatgccttcaagaaatttaaaa
gttggaagcaaatttgaaataaaaactatagtaaatcttggagatatagcacctgattct
gtgagagttgagctttattatggtaaattaagcatgaaagaagagattatagagccttct
ataattgaaatgaaacattctgctgatttaggtaatggaagacattcatttagcggagct
ttagtatgtaacaatagcggacagagcggttttgctataagaatgtacccatacaataaa
gatttgagttacaaatttgatatgaagcttattatttggagctaa

DBGET integrated database retrieval system