KEGG   Paraburkholderia phenoliruptrix: BUPH_00179Help
Entry
BUPH_00179        CDS       T02300                                 

Definition
(GenBank) maltose alpha-D-glucosyltransferase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00500  Starch and sucrose metabolism
bpx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BUPH_00179
Enzymes [BR:bpx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BUPH_00179
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     BUPH_00179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AFT87650
UniProt: K0DRQ9
LinkDB All DBs
Position
2:complement(3616..5280)
Genome map
AA seq 554 aa AA seqDB search
MLNDLWYKNAIVYCLSVGSFMDANGDGVGDFKGLLRRLDYLQGLGVTTIWLMPFQPSPGR
DNGYDISDYYNVDPKYGTLGDFSEFTHACRERGLRVMIDLVVNHTSDQHPWFREARSDPD
SPYRDWYVWSDRQPPNAKDGVVFPGVQKSTWTFDKEAKRWYFHRFYEFQPDLNTANPYVQ
AELLKIMGFWIQLGVSGFRMDAVPFVIATKGPQVRKPVEQYDMLRAFREFLQWRQGDAII
LAEANVLPNTDLEYFGDEGERLQMMFNFQLNQNTFYTLATGDTAPLKKALTATRPRPATA
QWGVFLRNHDELDLGRLTPEQRAAVFAAFAPDPDMQLYERGIRRRLAPMLAGDRRRLELA
YSLMLTLPGTPVFRYGDEIGMGDDLRLPERECARTPMQWSAEPQGGFTKHPKPPCRVITG
GAYGFERINVAGQRRDPNSLLNWMERMIRMRREVPEISWGDFHVLRASRDDVLALRYDWR
NNSVLCLHNFGAEACTVKFRSGCAEPGQNRLINLLSDDHSEESDDGRHAVVLEPYGYRWY
RVGGLDYLLRRSEI
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgctcaatgatctctggtacaagaacgccattgtctattgcctttcggtaggcagcttc
atggacgcgaacggcgacggcgtgggcgacttcaagggcctgctgcgccgcctcgactat
ctgcaagggctcggcgtgacgacgatctggctgatgccgttccagccctcgccaggccgc
gacaatggctacgacatctccgactattacaacgtcgatccgaaatacggcacgctcggc
gacttctccgaattcacgcatgcgtgccgcgagcgcggcctgcgcgtgatgatcgacctc
gtggtcaatcacacgtccgatcagcacccctggttcagggaagcacgcagcgatcctgac
tcgccgtatcgcgactggtatgtgtggtccgacaggcagccgccgaacgcgaaagacggc
gtggtgtttcccggcgtgcagaagtcgacatggacgttcgacaaggaggcgaagcgctgg
tatttccatcgcttctacgaattccagcccgatctgaacaccgcgaatccgtatgtgcaa
gccgaactgctgaagatcatgggcttctggatccagctcggcgtgtcgggattccgcatg
gacgccgtgcccttcgtgatcgcgaccaaaggcccgcaggtgcgcaaacccgtcgagcaa
tacgacatgctgcgcgcgtttcgcgagtttctgcagtggcggcagggcgacgcgatcatc
ctcgccgaggcgaacgtgctgccgaatacggacctcgaatatttcggcgacgaaggcgag
cgtctgcagatgatgttcaatttccagctgaaccagaacacgttctacacgctcgcaacc
ggcgacaccgcgccgttgaagaaggcgctgacggccacgcgcccgcgtccggcgaccgca
caatggggcgtgtttctgcgcaatcacgacgagctcgacctcggccgcctgacgcccgaa
cagcgcgcagccgtgttcgccgcgttcgcacccgatccggacatgcagctctacgagcgc
ggcatccgccgccggctcgcgcccatgctcgcgggcgaccggcgccgtctggagctggcc
tacagcctgatgctgaccttgcccggcacgccggtgttccgttacggcgatgaaatcggc
atgggcgacgacctgcgcctgcccgagcgcgaatgcgcgcgcacgccgatgcaatggtcc
gccgaaccgcagggcggcttcaccaagcaccccaagccgccgtgccgcgtgataacgggc
ggcgcttatggtttcgagcgcatcaatgtggcggggcagcggcgcgatccgaattccttg
ctgaactggatggagcggatgatccgcatgcgccgcgaggtgccggaaatcagctggggc
gattttcacgtgctgcgcgcctcgcgcgacgacgtgctcgcgcttcgttatgactggcgc
aacaactcggtgctctgcctgcataacttcggcgccgaggcgtgcacggtgaaattccgc
tcgggctgcgcggagccgggccagaaccggctcatcaacctgctctcggacgatcacagc
gaggagagcgacgacggccgccatgcagtcgtgctcgagccttacggctaccgctggtat
cgggtgggcgggctcgattatctgctcagacgcagcgagatctag

DBGET integrated database retrieval system