KEGG   Paraburkholderia phenoliruptrix: BUPH_00546Help
Entry
BUPH_00546        CDS       T02300                                 

Definition
(GenBank) ribulose-bisphosphate carboxylase small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00630  Glyoxylate and dicarboxylate metabolism
bpx01100  Metabolic pathways
bpx01120  Microbial metabolism in diverse environments
bpx01200  Carbon metabolism
Module
bpx_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:bpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BUPH_00546
Enzymes [BR:bpx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BUPH_00546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AFT88010
UniProt: K0DSS8
LinkDB All DBs
Position
2:complement(429362..429790)
Genome map
AA seq 142 aa AA seqDB search
MRITQGTFSFLPELTDEEISLQIDYALSQGWACSVEFTDDPHPRNTYWEMWGLPMFDLHD
AAGVLQEVKACRAARPDHYIKINAFDSVRGFETMRLSFIVNRPEEEPGFRLTREDGPGRV
QRYGLAGYASERPAGQRYGTER
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattacacagggcacgttttccttcctgcctgaattgaccgacgaggaaatcagt
ttgcagatcgactatgcattgagccagggctgggcctgctccgtcgaattcaccgacgac
ccgcacccgcgcaatacctattgggaaatgtggggcctgccgatgttcgacctgcacgac
gcagcaggcgtgctgcaggaagtgaaagcctgccgcgcggctcggcccgatcactacatc
aagatcaatgcgttcgattcggtgcgcggctttgagacgatgcgcctgtcgttcatcgta
aatcgtccggaggaagagccgggcttccgcctcacacgcgaggatgggcctgggcgcgtg
caacgttatgggctggcgggttacgcgagcgagcggcccgccggccaacgctacggtacg
gagcgctga

DBGET integrated database retrieval system