KEGG   Paraburkholderia phenoliruptrix: BUPH_00649Help
Entry
BUPH_00649        CDS       T02300                                 

Definition
(GenBank) DNA polymerase II
  KO
K02336  DNA polymerase II [EC:2.7.7.7]
Organism
bpx  Paraburkholderia phenoliruptrix
Brite
KEGG Orthology (KO) [BR:bpx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bpx03400]
    BUPH_00649
Enzymes [BR:bpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BUPH_00649
DNA repair and recombination proteins [BR:bpx03400]
 Prokaryotic Type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    BUPH_00649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 DNA_pol_B_2 P63C WD40_4
Motif
Other DBs
NCBI-ProteinID: AFT88110
UniProt: K0DT65
LinkDB All DBs
Position
2:541852..544236
Genome map
AA seq 794 aa AA seqDB search
MAQVVGLTEFEQGFILTRHWRDTPAGTEVDFWLATDAGPRHIRLRHQTSVAFIPAQQRER
AETILRREAPLDLRSLELRDFHHRPVLGLYCPQYRQLTGYEKRLKQGGVEVYEADIFPPE
RYMMERFITAPVWFSGERKSDKALVNGELKPAADYRPSLRLVSLDIETSVHAELYSIALE
GCGQRQVYMLGPPNGDAGKLDFDLEYCETRAQLLEKLNTWMERHDPDAIIGWNLVQFDLR
VLQQHAEQYRVPLRLGRGGAVMEWREHGLKQNHYFAGAAGRLIIDGIEALRSATWSFPSF
SLEHVSQAVLGEGKSIDNPYQRMDEIQRRFDEDKPALAQYNLKDCELVTRIFAKTELLPF
LLERATVTGLPADRSGGSVAAFTHLYMPRMHRQGYVAPNVGDVAGAASPGGFVMDSRPGL
YDSVLVLDYKSLYPSIIRTFLIDPVGLVEGMLHPGDDECVPGFLGARFSRTRHCLPSIVG
QVWQGRETAKREHNKPLSQALKIIMNAFYGVLGSTGCRFFDPRLASSITMRGHEIMHRTR
ELIQAEGYEVIYGDTDSTFVWLRHAHDEDDAGRIGRALVEHINAWWRQDLQRRFGLDSAL
ELQFERHYRRFFMPTIRGAEEGSKKRYAGLTVSADGHEEIVYKGLETVRTDWTPLAQQFQ
QELYRRIFTQQPYQDYVRDYVRDTLAGKLDDQLVYRKRLRRPLGDYERNVPPHVRAARVA
DEFNRRQGRPLQYQSGGWISYVMTIAGPEPLETLRSAIDYEHYLTRQLQPVADAILPLLR
DDFTRLTSGQKQLF
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggtggtgggtttgacagagttcgagcagggtttcatcttgacgcggcattgg
cgggacacgcccgccggtaccgaagtcgatttctggctggcaacggacgccgggccccgt
cacatccgtttgcgccatcaaacatcggttgcattcattcctgcgcaacagcgcgaacgt
gcagaaacgattttgcgccgcgaggcaccgctcgatctgcgttcgctcgaactgcgcgac
tttcatcaccggccggtgctgggactttactgtccgcaatatcgccagttgaccggctac
gagaagcgcctgaagcaaggcggcgtggaggtttacgaggccgatatctttccgccggag
cgctacatgatggagcgcttcatcaccgcgccggtgtggttcagcggcgagcggaagagc
gacaaggcgctcgtgaatggcgagctgaaaccggcggcggactatcggccttcattgaga
ctggtgtcgctcgacatcgagaccagcgttcacgcagaactgtattcgatcgctctcgaa
ggttgcggccagcgccaggtgtacatgctcgggccgccgaacggcgatgccggcaagctc
gacttcgacctcgaatactgcgaaacgcgcgcacagctgctggaaaaattgaacacgtgg
atggagcggcacgatcccgatgcgatcatcggctggaatctcgtgcagttcgacttgcgg
gtgctgcagcagcacgccgaacagtaccgcgtgccgttgcggcttggacgcggcggcgcc
gtgatggagtggcgcgagcacggactgaagcagaaccactatttcgcgggcgccgcggga
cgattgattatcgacggcatcgaggcgctgcgttcagccacgtggagctttccgtcgttc
agcctcgaacatgtgtcgcaagccgtgctgggcgaaggcaaatccatcgacaatccctat
cagcgcatggatgaaatccagcgccgcttcgacgaggacaagcccgccctcgcccagtac
aacctgaaggactgcgaactggtcacgcgcatcttcgccaaaacggaactgctgccgttt
ctgctcgaacgcgccaccgtaaccggcctgccggccgatcgcagcggcggttcggtggca
gcgttcacgcatttgtacatgccgcgaatgcaccggcaaggctatgtggcgcccaacgtc
ggcgatgtggccggcgccgcgagtccgggcggtttcgtcatggactcgcgcccgggcctc
tacgattcggttctggtgctcgactacaagagcctgtatccgtcgatcattcgcacgttt
ttgatcgacccggtcgggctcgtggaaggcatgctccatcctggcgacgatgagtgcgtg
ccgggctttctcggcgcacgcttctcacgcacgcgccactgtctgccgtcgatcgtgggc
caggtctggcaaggccgcgaaaccgccaagcgggagcacaataagccgctctcgcaggcg
ctgaagatcatcatgaatgcgttttacggcgtgctgggttcaaccggttgccgctttttc
gacccgcgtctggcctcgtcgattaccatgcgcggccatgaaatcatgcaccgcacacgc
gagctgatccaggccgaaggctatgaagtcatctacggcgacacggactcgaccttcgtc
tggctcaggcacgctcatgacgaagacgacgcgggccgcatcggacgtgcgctcgttgaa
catatcaacgcatggtggcggcaagatttacaacggcgcttcgggctcgacagcgcgctc
gaattgcaattcgagcgccattaccggcgttttttcatgccgacgattcgcggcgcggaa
gaaggcagcaagaagcgctatgccgggctcaccgtgtcggcggacgggcacgaagagatc
gtctacaagggccttgaaacggtacgcaccgactggaccccgctcgcgcagcagttccag
caggagctttataggcgcatcttcacgcagcagccctatcaggactacgtgcgcgactat
gtgcgcgatacgctcgccggcaagctcgacgatcagcttgtgtatcgcaagcgcctgcgc
agaccgcttggcgactacgaacgcaatgtgccgccgcatgtgcgcgccgcccgcgtggcc
gacgaattcaaccgccggcagggccgtccgctgcaataccagagcggcggctggatcagc
tacgtgatgacgattgccggccccgagccgctcgaaacactgcgttccgcaatcgactac
gaacactacctcacgcgtcaattgcaacccgttgccgatgcaatcttgccgctgttgcgc
gacgactttacacggctcacgtccggccaaaagcagttgttttga

DBGET integrated database retrieval system