KEGG   Paraburkholderia phenoliruptrix: BUPH_00733Help
Entry
BUPH_00733        CDS       T02300                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00250  Alanine, aspartate and glutamate metabolism
bpx00410  beta-Alanine metabolism
bpx00640  Propanoate metabolism
bpx00650  Butanoate metabolism
bpx01100  Metabolic pathways
bpx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BUPH_00733
   00650 Butanoate metabolism
    BUPH_00733
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BUPH_00733
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BUPH_00733
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bpx01007]
    BUPH_00733
Enzymes [BR:bpx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BUPH_00733
Amino acid related enzymes [BR:bpx01007]
 Aminotransferase (transaminase)
  Class III
   BUPH_00733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AFT88192
UniProt: K0DU22
LinkDB All DBs
Position
2:642565..643854
Genome map
AA seq 429 aa AA seqDB search
MNLKNADLKSRKDAATPRGVGVMCDFYAERAENAELWDVEGRRFIDFAAGIAVCNTGHRH
PKIVAALRDQLDHFTHTAYQIVPYASYVELAEKLNQRAPGDHPKKTAFFTTGAEAVENAI
KIARAATGRPGVIAFTGGFHGRTLMGMALTGKVAPYKLGFGPFPSDVFHAPFPNPLHGVS
TADSLKAIEFLFKADIDPKRVAAIIFEPVQGEGGFYPAPVEFVRALRKLCNEHGILLIAD
EVQTGFARTGKLFAMHHYDVVPDLMTVAKSLAGGMPLSGVIGRAEVMDAAAPGGLGGTYA
GNPLALAAAHAVLDIIDEEKLCERAVVLGERVKTKLIALQKDAPQIADVRGPGAMVAVEF
CKPGSTEPDADFTKRVQARALERGLLLLVCGVYSNVVRFLFPLTIQDTVFDEALAILEDV
IKDSVAVAA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgaagaacgcagacctgaagagccgcaaagacgcagccacgccgcgcggcgtc
ggcgtcatgtgcgatttttacgccgagcgcgccgaaaacgccgagctctgggatgtggag
ggccgccgcttcatcgacttcgcggcgggcattgcggtgtgcaacacggggcatcgtcat
ccgaagatcgtggcggcgctgcgcgaccagctcgatcatttcacgcacactgcgtatcag
atcgtgccgtacgcgtcctatgtggaactggcggaaaagctcaatcagcgcgcgccaggc
gatcatccgaagaaaacggctttcttcaccactggcgccgaggccgtggaaaacgcaatc
aagatcgcgcgcgccgcgaccggccgtcccggcgtaatcgccttcacgggcggctttcac
ggccgcacgctgatgggcatggcgctgaccggcaaggtcgcgccgtacaagctgggcttt
gggccgttcccgtcggacgtgttccatgcgccgttcccgaatccgctgcatggcgtcagt
acggcagattcgctcaaggcaattgaattcctgttcaaggccgacatcgatccgaagcgt
gtggccgccatcattttcgagccggttcagggcgaaggcggcttctatccggcgccggtc
gagttcgtgcgcgcgctgcgcaagctgtgcaacgagcacggcattctgctgatcgcggac
gaagtgcaaaccggcttcgcgcgcaccggcaagctgttcgccatgcatcactacgacgtg
gtgcccgacctgatgacggtcgcgaagagcctcgcgggcggcatgccgctgtcgggcgtg
atcggccgcgccgaggtgatggatgcggcggcgcccggcggactcggcggcacgtacgcc
ggcaatccgctcgcgctcgccgcggcgcatgcggtgctcgacatcatcgacgaagagaag
ctttgcgagcgcgccgtcgtgctcggcgagcgcgtgaagaccaaactgatcgcgctgcaa
aaagacgcgccgcagatcgccgacgtgcgcggccccggcgccatggtggcggtcgagttc
tgcaagccgggcagcacggaaccggacgcggacttcacgaagcgcgtgcaggcgcgcgcg
ctcgaacgcgggctgctgctgctcgtgtgcggcgtgtattcgaacgtggtccgcttcctg
ttcccattgacgattcaggacaccgttttcgacgaggcgctcgccattctcgaagacgtg
atcaaggacagcgtcgctgtcgcagcctga

DBGET integrated database retrieval system