KEGG   Paraburkholderia phenoliruptrix: BUPH_01488Help
Entry
BUPH_01488        CDS       T02300                                 

Definition
(GenBank) maltose alpha-D-glucosyltransferase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00500  Starch and sucrose metabolism
bpx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BUPH_01488
Enzymes [BR:bpx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BUPH_01488
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     BUPH_01488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AFT88934
UniProt: K0DZZ9
LinkDB All DBs
Position
2:complement(1531171..1534638)
Genome map
AA seq 1155 aa AA seqDB search
MKRDDSSETASQASASTATATAAAAKARTRRRGKPAALSDDPLWYKDAIIYQVHIKSFFD
ANNDGVGDFPGLIAKLDYIAELGVNAIWLLPFYPSPRRDDGYDIADYRNVHPDYGQLSDV
KRFIQEAHARGIRVITELVINHTSDQHPWFQRARRAKPGSNHRNFYVWSDTDKKYPETRI
IFIDSEPSNWTHDPVAGAYYWHRFYSHQPDLNFDNPAVLREVLQIMRFWLDMGIDGLRLD
AVPYLVEREGTNNENLPETHAILKKIRATIDAEYPNRMLLAEANQWPEDVKEYFGDEDEC
HMAFHFPLMPRIYMSIASEDRFPITDIMRQTPDLAESNQWAIFLRNHDELTLEMVTDSER
DYLWNTYASDRRARLNLGIRRRLAPLMERDRRRIELINSLLLSMPGTPVIYYGDELGMGD
NIHLGDRDGVRTPMQWSSDRNGGFSRADPEQLVLPPVMGALYGFDAVNVEAQSRDPHSLL
NWTRRMLATRRAKQTFGRGTIRFLKPENRKILAYLREMPGEPPILCVANLSRAPQAVELD
LSEFNGAVPIEMTADSVFPAIGQLTYLLTFPPYGFLWFLLCEGGQRPTWAQAHPEPLPEF
VTIVIREGQTGPTPENVRLLESEVLPSWLSRRRWFASKDQKMHAVRLAALTTIPNGGFAF
TEIEADVGDHTERYVVPIAITWGGETTTPLFLQLALARVRRGRNVGHLTDAFALPIFAHG
VLRKLRERAVVPTVQKSEIRFIPTERFVELDGLGERPEIRWLAAEQSNSSLIIADAAVLK
LVRRLVSGIHPEAEISRYLTQLGYANTAPLFGEVVRVDPEGVPHTLAILQGFVDNQGDAW
NWSLDYLRRSVDELAITVDTETSSAPDRANEAILLEGYAALAGIIGRRLGELHVALASPT
DDPAFSPEPADADQVKAWVDGTQSMLASALDLLAPRIDQLLDAETKALAQSLIDRRAALV
EAVNRLISADTRALRIRIHGDFHLGQVLVAQGDAYLIDFEGEPARSLEERRRKSSPLRDV
AGLMRSLSYASAAAQSTTEAAPQQTADRKRVLFDRFRAHATETFLKEYRAATAEAPTPLV
APEAEQALLDLFLIEKAAYEVRYEAANRPTWLSLPVRGLAALASRLLGDTGAPHDPSTEA
RDAATPPHPAEGDYE
NT seq 3468 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtgacgattcctcagagaccgcatcgcaggcaagcgcaagcacggcaaccgca
accgctgctgcagcgaaagcgcgcacgcgtcgccgcggcaagcccgccgcgctgagcgac
gatccgctctggtacaaggacgcaatcatctaccaggtgcacatcaagtcgttcttcgat
gcgaataacgacggcgtcggcgatttccccggcctcatcgcgaagctcgactacattgcc
gaactcggcgtgaacgcgatctggctgctgccgttctacccgtcgccgcggcgcgacgac
ggctacgacattgccgattaccgtaacgtgcaccccgactacggccagctttccgacgtc
aaacgcttcattcaggaagcgcacgcgcgaggtatccgcgtgattaccgaactcgtgatc
aaccacacgtcggatcagcacccgtggttccagcgcgcgcggcgcgcgaagcccggctcg
aatcatcgcaacttctatgtgtggtccgacaccgacaagaagtatccggaaacgcgcatt
atttttatcgactccgagccgtcgaactggacgcacgatccggttgcgggcgcgtactac
tggcaccgcttctattcgcatcagcccgatctgaacttcgacaatcccgcggtgctgcgg
gaagtgctgcagatcatgcgtttctggctcgatatgggcatcgacgggctgcggctcgac
gcggtgccgtacctcgtcgaacgcgagggcacgaacaacgagaacctgcccgaaacgcac
gcgatcctgaagaagattcgggcgaccatcgacgccgagtatccgaaccgcatgctgctc
gccgaggccaaccagtggccggaagacgtgaaggaatatttcggcgacgaagacgaatgc
cacatggcatttcacttcccgctgatgccgcgcatctacatgtcgattgcgagcgaggac
cgctttccgattaccgacatcatgcggcaaacgccggacctcgccgagtcgaatcaatgg
gcgattttcctgcgcaatcacgacgagctcacgctcgaaatggtcacggactccgagcgc
gattacttgtggaacacctacgcgagcgaccgccgcgcgcgcctgaacctcggcattcgt
cgccggctcgcgccgctgatggagcgcgaccgccgccgcatcgagctgatcaattcgctg
ctgctctcgatgcccggcacgcccgtcatctattacggcgacgaactcggcatgggcgac
aacattcacctcggcgaccgcgacggcgtgcgcacgccgatgcaatggtcgtcggatcgc
aacggcggcttctcgcgtgccgatcccgagcagctcgtgctgccgccggtaatgggcgcg
ctctacggcttcgacgccgtcaacgtcgaagcgcaaagccgcgatccgcattcgctgctc
aactggacgcggcgcatgctcgccacgcgtcgcgcgaaacagaccttcgggcgcggcacg
atccgcttcctgaaaccggagaatcgcaagattctcgcgtatctgcgtgaaatgcccggc
gagccgccgattctttgcgtggcgaatctgtcgcgcgcaccgcaggcagtcgaactcgat
ctgtccgagttcaacggcgccgtgccgatcgaaatgaccgccgactcggtgttccctgcc
atcggccaactgacttatctgctgacgttcccgccgtacggcttcctgtggttcctgctg
tgcgaaggcggtcagcgtccgacgtgggcgcaggcgcatcccgagccgttgcccgagttc
gtcaccattgtgatccgcgaaggccagaccggtccgacgcccgaaaacgtgcggctgctc
gagtccgaagtgctgccttcgtggctgagccgccgccgctggtttgcgtcgaaggatcag
aagatgcatgcggtgcggctcgccgcgttgaccacgataccgaacggcggcttcgcgttc
accgaaatcgaagcggacgtcggcgaccacaccgaacgctacgtcgtaccgattgcaatc
acgtggggcggcgagacgaccacgccgctctttctgcagctcgcgctggcacgtgtgcgg
cgcggccgcaacgtcgggcatctgaccgacgcattcgcgctgccgatcttcgcgcacggc
gtgctgcgtaaattgcgcgagcgcgcagtcgtgccgaccgtgcagaagagcgagatccgg
ttcattccgactgagcgcttcgtggaactcgacggtctcggcgaacgcccggagatccgc
tggctcgcggcggaacaaagcaacagttcgctgatcatcgcggacgccgcggtgctcaag
ctcgtgcggcgtctcgtgagcggcattcatccggaagcggaaatcagccgctatctcacg
cagctcggctatgccaacaccgcgccgctcttcggcgaagtggtgcgcgtggatcccgag
ggcgtgccgcatacgctcgcgatcctgcaaggctttgtcgacaatcagggcgatgcgtgg
aactggtcgctcgattatctgcgtcgctcggtcgacgaactggcgatcacggtcgacacg
gagacctcgtcggcccccgatcgcgccaacgaggccattctgctcgaaggctacgcggca
ctcgccggcatcatcggcagacggctcggcgagctgcatgtcgcgctcgcctcgccgacc
gacgacccggcgttctcgcccgaacccgccgacgccgaccaggtgaaggcgtgggtcgac
ggcacgcagtccatgctcgcaagcgcgctcgacctgctcgcaccgcgcatcgaccagctg
ctcgatgccgagacgaaagcgctcgcgcaaagtctgatcgaccggcgcgcggcgctcgtc
gaagccgtgaatcgactcatatcggcggacacgcgggcgctgcgcattcgtattcacggc
gacttccatctcgggcaggtgctggtcgcgcagggcgacgcgtatctgatcgacttcgaa
ggcgagcccgcacgttcgctcgaagagcgtcgccggaaatcgagtccgctgcgcgacgtg
gccgggctgatgcggtcgctgtcgtatgcgagcgccgccgcgcagtccaccacagaagcc
gcgccgcaacagaccgcggaccgcaagcgcgtgttgttcgaccgtttccgcgcgcacgcc
accgagacgttcctgaaggaataccgcgcggccaccgccgaagcaccgacgccgctcgtc
gcgcccgaggcggaacaggcgctgctcgatctgttcctgatcgaaaaggccgcgtacgaa
gtccgctatgaagcggccaaccgtccgacgtggctcagcctgccggtgcgcggtctcgcg
gcgctcgcgagccggctgctcggcgacaccggtgcgccgcatgatccttcaaccgaggcg
cgagacgccgccaccccgcctcatccggccgagggcgactatgagtga

DBGET integrated database retrieval system