KEGG   Paraburkholderia phenoliruptrix: BUPH_01906Help
Entry
BUPH_01906        CDS       T02300                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00020  Citrate cycle (TCA cycle)
bpx00310  Lysine degradation
bpx00380  Tryptophan metabolism
bpx01100  Metabolic pathways
bpx01110  Biosynthesis of secondary metabolites
bpx01120  Microbial metabolism in diverse environments
bpx01130  Biosynthesis of antibiotics
bpx01200  Carbon metabolism
Module
bpx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BUPH_01906
  Amino acid metabolism
   00310 Lysine degradation
    BUPH_01906
   00380 Tryptophan metabolism
    BUPH_01906
Enzymes [BR:bpx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BUPH_01906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AFT85478
UniProt: K0DNL8
LinkDB All DBs
Position
1:1601437..1604298
Genome map
AA seq 953 aa AA seqDB search
MMKQFQSNSYLFGGNAPYVEEMYEAYLDNPASVPENWRSYFDALQNVPASDGSNANDVAH
GPIVESFAQRAKANAFIPRTATGGEDLATARKQVYVQSLIGAYRFLGSQWANLDPLKRRE
RPAIPELEPAFYDFTEADMDQEYSATNLYFGFERASLREIVKALRDTYCGTIGAEYMYIS
DPEQKRWWKEKLESIRSTPNFSNEKKKHILNRLTAAEGLERFLHTKYVGQKRFSLEGGES
FIAAMDEVVRHGGARGVQEIVIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPAGD
VKYHKGFSSDVSTEGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDDSGTQVLPVQI
HGDAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDSRSTLYCSDVVKM
IEAPVLHVNGDDPEAVVLATQLAIDFRMQFHKDVVVDIVCFRKLGHNEQDTPAVTQPLMY
KTIAKHPGTRALYAEKLVQQGVITAEDAEEYVKAYRKAMDEGHHTVDPVLSNYKSKYAVD
WVPFLNRKWTDAADTAVPLAELKRLAERITTIPENFKVHPLVERVINDRRAMGRGEAKLD
WGMGEHLAFASLVASGYAVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNIAEG
QAKFTVIDSVLSEEAVLGFEYGYSTAEPNTFVAWEAQFGDFVNGAQVVIDQFISSGEVKW
GRVSGLTMLLPHGYEGQGPEHSSARIERFLQLCADHNMQVVQPTTPAQIFHLLRRQMIRL
FRKPLIVATPKSLLRHKEAVSDLSELAKGSFQPVLGEVDEAIDAKKVKRVLVCSGRVYYD
LVAHRREAKSNDVAIIRIEQLYPFAHKQFEAEMKKYDNATEVVWVQDEPQNQGPWFYIEH
HLKEGMKEGQKLAYSGRPASASPAVGYYAKHYEQQKALVEGAFGRLKSASIAK
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagcaattccagtcgaactcttatctgttcggcggcaatgctccgtacgtagaa
gaaatgtacgaagcatatctcgacaatccggcgtcagtgcccgagaactggcgcagctat
ttcgacgcgttgcagaatgtccctgcatcggacggcagcaatgccaacgacgtggcccat
ggcccgatcgtcgaatcgtttgcgcaacgggccaaggccaatgccttcatcccgcgcacc
gcaaccggcggcgaagacctcgctaccgcgcgaaagcaagtctatgtgcagtccctcatc
ggcgcatatcgcttcctcggctcgcaatgggccaacctggatcctctgaagcgccgcgaa
cgtcccgccattcccgaactcgaacctgcgttctacgacttcaccgaagccgacatggac
caggagtacagcgccacgaatctgtatttcggcttcgagcgcgcgtcgctgcgcgagatc
gtcaaggcgctgcgcgacacgtattgcggcacgatcggcgccgaatacatgtacatcagc
gatccggaacagaagcgctggtggaaggaaaagctggagtcgatccgctccacgccgaat
ttctcgaacgagaagaaaaagcacatcctgaatcgcctgacggccgctgaaggcctcgag
cgcttcctccacaccaagtacgtcggccagaagcgcttctcgctggaaggcggcgaaagc
ttcatcgcggccatggacgaggtcgtgcgtcacggcggtgcccgcggcgtgcaggaaatc
gtcatcggcatggcccaccgcggccgtctgaacgtgctggtcaatacgctcggcaagatg
cccgccgacctgttcgccgaattcgaaggcaagcacgtcgacgatctgcccgccggcgac
gtgaagtaccacaagggcttctcgtcggacgtctcgacggaaggcggcccggttcacctg
tcgctcgcattcaacccgtcgcacctcgaaatcgtcaacccggtggtcgagggttcggcg
aaggcgcgtatggatcgccgcggcgacgacagcggcacgcaggtgctgccggtgcagatt
cacggcgacgccgctttcgcgggccagggcgtcgtgatggaaacgctgaacctcgcacaa
acgcgcggttacggcacgcacggcacgctgcacatcgtcatcaacaaccagatcggcttc
accacgtcggacccgcgcgactcgcgctccacgttgtactgctcggacgtcgtcaagatg
atcgaggcgccggtgctgcacgtgaacggcgacgatccggaagcagtcgtgctggccacg
cagctggctatcgacttccggatgcagttccacaaggacgtcgtggtcgacatcgtctgc
ttccgtaagctgggtcacaacgagcaggacacgccggctgtgacgcagccgctgatgtac
aagacgatcgccaagcatccgggcacgcgcgcgctgtatgccgaaaagctggtccagcaa
ggcgtgatcaccgccgaagacgcggaagagtacgtcaaggcgtatcgcaaggcgatggac
gaaggccatcacacggtcgacccggtgctctcgaactacaagagcaagtacgcggtggac
tgggtgccgttcctgaaccgcaagtggaccgacgcagccgacacggccgtgccgctcgcg
gaactgaagcgcctcgccgagcgcatcaccacgattccggaaaacttcaaggttcacccg
ctcgtcgagcgcgtgatcaacgaccgtcgcgccatgggccgcggcgaggccaagctcgac
tggggcatgggcgagcacctcgcgttcgcttcgctggtcgcttcgggctacgccgtgcgt
ctgaccggccaggactcgggccgcggtacgttcacgcaccgtcacgcggtgctgcacgac
cagaaccgcgagcgctggaacgacggcacctacgtgccgctgcagaacatcgccgaaggt
caggcgaagttcacggtgatcgactcggtgctgtcggaagaagcggtgctcggtttcgaa
tacggttactcgaccgctgaaccgaacacgttcgtcgcgtgggaagcgcagttcggcgac
ttcgtgaacggcgcgcaagtcgtgatcgaccagttcatctcgtcgggcgaagtgaagtgg
ggccgcgtgtcgggcctgaccatgttgctgccgcacggctacgaaggccagggtccggag
cactcgtccgcgcgtatcgagcgtttcctgcaactgtgcgcagaccacaacatgcaggtc
gttcagccgaccacgccggcgcagattttccacctgttgcgccgtcagatgatccgcctg
ttccgcaagccgctgatcgtcgcaacgccgaaatcgctgctgcgccacaaggaagcggtg
tcggatctgtcggaactggcgaagggttcgttccagccggtgctcggcgaagtggacgaa
gccatcgacgcgaagaaggtcaagcgcgtgctggtgtgctcgggccgcgtgtactacgac
ctcgtcgcgcatcgccgcgaagcgaagtcgaacgacgtcgcgatcatccgtatcgaacag
ctgtatccgttcgcgcacaagcagttcgaagcggaaatgaagaagtacgacaacgcgacg
gaagtggtgtgggtgcaggacgagccgcagaatcagggcccgtggttctacatcgagcat
cacctgaaggaaggcatgaaggaaggacagaagctggcatacagcggccgtccggcttcg
gcttcgccggcagtgggctactacgcgaagcactacgagcagcagaaggcgctggtcgaa
ggcgctttcggccgcctcaagagcgcgtcgatcgctaaataa

DBGET integrated database retrieval system