KEGG   Paraburkholderia phenoliruptrix: BUPH_03410Help
Entry
BUPH_03410        CDS       T02300                                 

Definition
(GenBank) L-iditol 2-dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
bpx  Paraburkholderia phenoliruptrix
Brite
KEGG Orthology (KO) [BR:bpx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BUPH_03410
Enzymes [BR:bpx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     BUPH_03410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Spermine_synth
Motif
Other DBs
NCBI-ProteinID: AFT86981
UniProt: K0DLH1
LinkDB All DBs
Position
1:complement(3403402..3404499)
Genome map
AA seq 365 aa AA seqDB search
MTNPFTPSDKQNMTAIVCHAPKDYRVEQVARPRPRAHELVIRIAACGICASDCKCHSGAK
MFWGGPSPWVKAPVIPGHEFFGYVEELGEGAAGHFGVEVGDRVIAEQIVPCGKCRYCKSG
QYWMCEVHNIFGFQREVADGGMAEYMRIPPTAIVHKIPDGISLEDAAIIEPLACAIHTVN
RGDLQLDDVVVIAGAGPLGLMMTQVAHLKTPKKLVVIDLVEERLALAREYGADVTINPKK
DDALAIVHSLTDGYGCDVYIETTGAPIGVNQGMDLIRKLGRFVEFSVFGADTTLDWSVIG
DRKELDVRGAHLGPYCYPIAIDLLARGLVTSKGIVTHGFSLEEWDEAIKVANSLDSIKVL
MRPRA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatccattcacaccatccgacaagcaaaacatgacggcgattgtctgccacgcg
ccgaaagactatcgcgtcgaacaggtggcgcggccgcgcccgcgagcgcacgaactggtg
atccgcattgcggcttgcggaatctgcgcgagcgattgcaaatgccattcgggcgcaaaa
atgttttggggcggcccgagtccgtgggtcaaagcgccggtgattccggggcacgagttc
ttcggctacgtggaggagctcggtgaaggcgcagccgggcacttcggcgtggaggtgggc
gaccgcgtgattgcggagcagatcgtgccgtgcggcaaatgccgctattgcaagtcgggc
caatactggatgtgcgaggtgcacaacatcttcggctttcaacgcgaagtcgcggacggc
ggcatggccgagtacatgcgcattccgccgaccgcgatcgtccataagattcccgatggc
atttctctcgaagacgccgccatcatcgaaccgctcgcgtgcgcaattcacaccgtgaat
cgcggcgatctgcagctggacgacgtcgtcgtgattgcaggcgcgggtccactcggcttg
atgatgacgcaggtcgcgcacctgaaaacgccgaagaagctggtcgtgatcgatctggtg
gaagagcgccttgcgctcgcgcgcgagtacggcgccgacgtgacgatcaacccgaaaaag
gacgacgcgctcgcgatcgtccattcgctgactgacggctacggctgcgatgtctacatt
gaaacgaccggcgcgccgatcggcgtcaaccaggggatggacctgattcgcaagctcggg
cgtttcgtggaattttcggtgttcggcgcggataccacgctcgactggtccgtgatcggc
gaccgcaaggagctcgatgtgcgcggcgcgcatctcgggccttattgctatccgatcgcc
atcgatctgctcgcgcgcggactcgtgacatcgaaaggcattgtcacacacgggttttcg
ctggaagaatgggacgaagcgatcaaggtcgccaattcgctcgattcgatcaaggtgctg
atgaggccgcgcgcgtga

DBGET integrated database retrieval system