KEGG   Paraburkholderia phenoliruptrix: BUPH_04124Help
Entry
BUPH_04124        CDS       T02300                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 5/6)
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00550  Peptidoglycan biosynthesis
bpx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpx00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BUPH_04124
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bpx01002]
    BUPH_04124
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bpx01011]
    BUPH_04124
Enzymes [BR:bpx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BUPH_04124
Peptidases [BR:bpx01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   BUPH_04124
Peptidoglycan biosynthesis and degradation proteins [BR:bpx01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BUPH_04124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AFT84360
UniProt: K0DHZ6
LinkDB All DBs
Position
1:241457..242686
Genome map
AA seq 409 aa AA seqDB search
MRFSTSGRLSFPSAASFVPSTLSRAITLGVVLPATLAASTAFAQVPPPAVNARSWVLVDA
TSNQVLASGNPDERVEPASLTKLMTAYLVFEALQTKKIAMDQTVTPSEAVRRVRTDESRM
FIEANKPVTVHDLVYGMIVQSGNDAAIALAELVGGSEAQFVNMMNTEAQRLGMTHTHFAD
VNGMPDPQHYTTAGDLAVLSARLIRDFPDYYNIFSVKEFTYNKIKQPNRNRLLWIDPTVD
GLKTGHTQAAGYCLIASAKRSLPGTPDASRRLVSVMMGETKEHDRVQDSLKMLNYGYSAY
DTVRLYKANQVVGTPRVYKGAQDSVQIGVKSDQYITVPKGMADKVKPQIDQMDPLIAPIA
NGQQVGTAKLVADGKVLAQFPVVALQAVPQAGVVGRVWDSLMLMFNKKK
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttttccacctccggccgcctgtctttcccctccgctgcatccttcgttccctcc
acgctcagccgcgccatcacgctcggcgtcgtgttgcccgccacgctcgcggccagcacc
gcgttcgcgcaagtgccgccgccggcggtgaatgcgcgctcgtgggtgctcgtcgacgca
accagcaatcaggtgctcgcgtcgggtaatccggacgagcgcgtggaaccggcatcgctt
accaagctgatgacggcgtatctcgtcttcgaagcactgcagacgaaaaagatcgcgatg
gaccagacggtgacgccgagcgaagcggtgcgccgcgtgcgcacggacgaatcgcgcatg
tttatcgaggcgaacaagcccgtcaccgtgcatgatctggtgtacggcatgatcgtccag
tcgggcaacgacgccgcgatcgcgctcgccgaactggtgggcggcagcgaggcgcagttc
gtcaacatgatgaacacggaggcgcagcgcctcggcatgacgcacacgcatttcgccgac
gtgaacggcatgcccgacccgcagcactacacgaccgcgggcgacctcgccgtgctgtcg
gcgcgtctgattcgcgacttccctgactactacaacatcttctcggtcaaggaattcaca
tacaacaagatcaagcagccgaaccgcaaccgtctgctgtggatcgacccgaccgtcgac
ggtctgaagaccggtcacacgcaagcggccggctactgcctgatcgcgagcgcgaagcgt
tcgctgccgggcacgccggacgcgtcgcgccgtctcgtctccgtgatgatgggcgagacg
aaggagcacgaccgcgtgcaggacagcctgaagatgctgaactacggctactccgcgtac
gacaccgtgcgtctgtacaaggcgaatcaggtggtcggcacgccgcgcgtctacaagggg
gcgcaggacagcgtgcagatcggcgtgaagagcgatcagtacatcacggtgccgaagggc
atggccgacaaggtcaagccgcagatcgaccagatggatccgctcatcgcgccgatcgcg
aacggtcagcaggtcggcaccgcgaagctcgtcgccgacggcaaggtgctcgcgcaattc
ccggtggtcgccttgcaggccgtgccgcaagccggcgtggtcggccgcgtgtgggactcg
ctgatgctcatgttcaacaagaaaaagtaa

DBGET integrated database retrieval system