KEGG   Paraburkholderia phenoliruptrix: BUPH_05369Help
Entry
BUPH_05369        CDS       T02300                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00620  Pyruvate metabolism
bpx00680  Methane metabolism
bpx01100  Metabolic pathways
bpx01120  Microbial metabolism in diverse environments
bpx01200  Carbon metabolism
Module
bpx_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BUPH_05369
  09102 Energy metabolism
   00680 Methane metabolism
    BUPH_05369
Enzymes [BR:bpx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BUPH_05369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 RAG1_imp_bd
Motif
Other DBs
NCBI-ProteinID: AFT84977
UniProt: K0DJM2
LinkDB All DBs
Position
1:complement(979734..982901)
Genome map
AA seq 1055 aa AA seqDB search
MTSSGSARSARRNTASPNASLDDAAASPAAASSTVETAQPPKAKRATSGAKAANAAKAVK
AEKTSAPVKADKTVKTSKADKSGEAAPSAKKGKAKAAGKAPVLQAVSEDTVMAAPKTNGR
TRDDKDHPLFQDIRYLGRLLGDVLREQEGDAVFDVVETIRQTAVRFRREDDNAAAQTLDK
KLRSLSPEQTVSVVRAFSYFSHLANIAEDRHRNRRHRIHALAGSAAQPGSIAYALERLVE
AGAAATPVLQQFFNDALIVPVLTAHPTEVQRKSILDAEHDVARLLAERDQQLTDRERAQN
ERMLRARVTSLWQTRMLRDSRLTVADEIENALSYYRATFLEEIPALYADIEEALKEHGLE
ARLPPFFQMGSWIGGDRDGNPNVTAETLEHAIARQAEVIFEHYLEQVHKLGAELSVSNLL
AGASDELKALAEISPDRSPHRTDEPYRRALIGMYTRLAASARVRLGEGAVPLRSAGRGAA
PIRATPYDDASEFVRDLHVLMDSLAAHHGAPLAAPRLAPLARAAEVFGFHLASIDLRQSS
DIHEAVIAELLKRAGVHDDYAALDESAKLEVLLAELAQPRPLRLPYAEYSDLVKSELSVL
EQARVTREKFGARAVRNYIISHTETVSDLVEVMLLQKETGLLQGQLGNADNPAKAALMVI
PLFETIPDLRNAPHIMRDLLALPGADSIIEHQGNEQEVMLGYSDSNKDGGFLTSNWELYR
AELALVSLFNERGITLRLFHGRGGTVGRGGGPTYQAILSQPPGTVDGQIRLTEQGEVIAS
KFGNPEIGRRNLETVVAATLEASLLPHGNAPADLPAFEETMQQLSDAAMASYRALVYETP
GFKEYFFESTPISEIAELNIGSRPASRKLQDPKHRKIEDLRAIPWGFSWGQCRLLLTGWY
GFGSAVAAYLDSAPSDAERGRRLSLLKKMHKSWPFFSTLLSNMDMVLAKTDLAVASRYAA
LVSDKKLRKHVFERIVAEWERTSKVLSEITGKRERLAENPLLARSIKNRFPYLDPLNHLQ
VELLKRHRAGDTNARVRRGIHLTINGIAAGLRNTG
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtcttccggatcggcgcgctccgcccgccgcaacactgcatcgcccaacgcttcc
cttgacgacgccgccgcgtccccggccgccgcatcgtccactgtcgagaccgcgcagccg
cccaaagccaaacgcgcgacatccggcgcgaaggccgccaacgcggcaaaagccgtcaaa
gccgagaaaacttccgcgcccgtcaaagcggacaaaaccgtgaagacgtcgaaggcggac
aaatccggcgaggccgcgccttccgcgaaaaagggcaaagccaaagccgccggcaaagcg
ccggtgctgcaagccgtatccgaagacaccgtcatggccgcgccaaagaccaacggccgc
acgcgcgacgacaaggatcatccgctcttccaggacatccgctacctgggacggctgctc
ggcgacgtgctgcgcgagcaggaaggcgacgcggtgttcgacgtcgtcgaaacgatccgg
cagacagccgtgcgttttcgccgtgaggacgacaacgccgccgcgcagacgctcgacaag
aagctgcgctcgctgagccccgagcaaacggtgagcgtcgtgcgcgcgttcagctatttt
tcgcatctcgcgaatattgccgaagaccgtcaccgcaaccgccgtcaccgcattcacgcg
ctcgccggctcggccgcgcagccgggcagcatcgcgtatgcattggagcggcttgtcgaa
gccggcgccgcggccacgcccgtcttgcagcagtttttcaacgacgcgctgatcgtgccc
gtgctcaccgcgcacccgacggaagtgcagcgcaagagcattctcgacgccgagcacgac
gtggcgcgcctgctcgccgaacgcgaccagcagttgaccgaccgcgagcgcgcgcagaac
gagaggatgctgcgcgcgcgcgtcacgtcgctgtggcaaacgcggatgctgcgcgactcg
cggctcaccgtcgccgatgaaatcgagaacgcactgtcgtattaccgcgcgacgttcctc
gaagaaattcccgcgctctacgccgatatcgaagaagcgctcaaagagcacggcctcgaa
gcgcgcctgccgcccttcttccagatgggcagctggattggcggcgaccgcgacggcaat
ccgaacgtcaccgccgaaacgctcgagcacgctatcgcgcgccaggccgaggtgatcttc
gaacattatctggaacaggtgcacaagctcggcgcggaactgtccgtgtcgaatctgctg
gccggcgcgagcgacgagctgaaggcgctcgccgaaatttcgccggaccgctcgccgcat
cgcacggacgagccgtatcggcgcgcgctgatcggcatgtacacgcggctcgcggcaagc
gcgcgcgtgcgtctcggcgaaggcgccgtgccgctgcgcagcgccggccgcggcgccgcg
ccgatccgcgccacgccttacgacgacgcctccgagttcgtgcgcgacctgcatgtgctg
atggattcgctcgccgcgcatcacggtgcgccgctcgccgcgccgcgtctcgcgccgctc
gcccgcgcggccgaggtgttcggcttccatctcgcgagcatcgacttgcgccagagttcg
gacattcacgaagcggtgatcgccgagctgctcaagcgcgcgggcgtccacgacgactac
gcggcgctcgacgaaagcgcgaagctcgaggtgctgctcgccgaactcgcgcagccgcgt
ccgctgcgcctgccgtatgccgagtactcggatctcgtgaagagcgagctcagcgtgctg
gagcaagcgcgtgtgacgcgcgaaaagttcggcgcgcgcgcagtgcgcaactacatcatt
tcgcacacggagacagtcagcgatctcgtggaagtgatgctgctgcaaaaagagacgggc
ttgctgcaaggccagctcggcaacgccgacaatccggctaaagccgcgctgatggtgatt
ccgcttttcgaaaccattcccgacttgcgcaacgcgccgcacatcatgcgcgatctgctc
gcgctgccgggcgccgattcgatcatcgagcaccagggcaacgagcaggaagtgatgctc
ggctattcggacagcaacaaggacggcggctttctcacgtcgaactgggagctgtaccgc
gcggaactcgcgctggtgtcgctcttcaacgagcgcggcatcacgctgcggctctttcat
gggcgcggcggcaccgtcggccgtggcggcggcccgacctatcaggcgattctgtcgcag
ccgccgggcaccgtcgacggtcagatccgtttgaccgagcaaggcgaagtgatcgcgagc
aagttcggcaatccggaaatcggccggcgcaatctggagacggtggtcgcggccacgctc
gaagcgtcgctactgccgcacggcaatgcgcccgccgatctgcctgccttcgaggaaacc
atgcagcagttgtccgacgcggccatggcctcgtatcgcgcgctggtgtatgagacgccc
ggcttcaaggagtatttcttcgagtcgacgccgatctccgagatcgccgagctgaacatc
ggcagccggccggcctcgcgtaagttgcaggacccgaagcatcgcaagattgaagatctg
cgcgcgattccgtggggcttttcatggggccaatgccggctgctgctgaccggctggtat
ggtttcggcagcgcggtcgccgcctatctcgacagcgcgccgagtgacgccgagcgcggg
cgccgtctttcgctgctgaagaaaatgcacaagagctggccgttcttctcgacgctgctc
tcgaacatggacatggtgctcgcgaagaccgacctcgcggtggcctcgcgctacgcggcg
ctcgtgtccgacaagaagctgcgcaagcacgtgttcgagcggatcgtcgcggaatgggag
cgcacgtcgaaggtgttgtcggagatcaccggcaaacgcgagcggctcgcggaaaatccg
ctgctcgcgcggtcgatcaagaaccgctttccgtatctcgatccgctcaatcacctgcag
gtcgaactgctcaagcgtcaccgtgcgggcgacaccaacgcgcgcgtgcggcgcgggatt
catttgaccatcaacgggatcgcggcggggttgcggaatacgggttag

DBGET integrated database retrieval system