KEGG   Paraburkholderia phenoliruptrix: BUPH_05878Help
Entry
BUPH_05878        CDS       T02300                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00440  Phosphonate and phosphinate metabolism
bpx01100  Metabolic pathways
bpx01120  Microbial metabolism in diverse environments
bpx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BUPH_05878
Enzymes [BR:bpx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BUPH_05878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: AFT89208
UniProt: K0DYS7
LinkDB All DBs
Position
2:1858619..1860343
Genome map
AA seq 574 aa AA seqDB search
MNAREPAFVSASRSARLRQMLVSNELEFMMEAHNGLSARIVREAGFKAIWGSGLAISAQF
GVRDNNEASWTQVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIE
DKQFPKTNSFINGEAQPLADIDEFCGKIKAGKDSQSDEHFSIVARVEALIAGWGMDEALR
RAEAYRRAGADAILIHSKLSRPDEILEFAREWAGRAPLVIVPTKYYSTPTEVFREAGIST
VIWANHLIRAATSAMQAVAREIHTSETLVNVEDRIAAVNEIFRLQDADEYSEAEDRYLSS
GRAAGSAVVLAASRGKGLEAVTQDRPKVMLPIAGKPLLRWLVDAFKKQGVNDITVVGGYR
ADAIDTAGIKLVVNEKHAETGELASLACALDKLSGDAVISYGDLLFRSYILRDLVESEAA
FSVVVDSSLTDAENASVRDFAWCSAADDRGLFGNKVLLRHVSSGQEASSAIASQAPHGRW
VGLLNVRGEGRERLQAVMRQLQARADFASLDMPALLNALIEAGESIEVQYVHGHWRGVND
LEDFRRAGDFAHGQTPLAASVGGAGSDMANGAAQ
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccgcgaacccgcctttgtctccgcttcacgcagcgcacgcctgcgccagatg
ctcgtcagcaacgaactcgaattcatgatggaggcgcataacggcttgtccgcgcgcatc
gtccgcgaagccggtttcaaggcgatctggggctcgggccttgcgatctccgcgcagttc
ggcgtgcgcgacaacaacgaagccagctggacgcaggtggtcgacaacctcgaattcatg
gccgacgcgagcgacctgccgattctgctcgacggcgacaccggttacggcaacttcaac
aatgtgcgccgcctcgtgcgcaagctggaacagcgcggcattgccggcgtgtgcattgaa
gacaagcagtttccgaagaccaatagctttatcaacggcgaggcgcagccgcttgccgat
atcgacgaattctgcggcaagatcaaggccggcaaagactcgcagtcggatgagcacttt
tcgatcgtcgcgcgcgtggaagcgctgatcgccggctggggcatggacgaggcgctgcgc
cgagcggaagcttaccgccgcgccggcgcggacgcgatcctgattcacagcaagctctcg
cgccccgacgagattctcgaattcgcgcgcgagtgggcgggccgcgcgccgctcgtcatc
gtgccgaccaagtactacagcacgccgacggaagtgttccgcgaagccggcatcagcacg
gtgatctgggcgaaccatctgattcgcgcggcgacttcggccatgcaggccgtcgcgcgc
gaaatccacacgagcgaaacgctcgtcaacgtggaagaccggatcgccgccgtcaacgaa
attttccgtttgcaggacgcggacgaatactcggaagcagaagaccgctatctgtcgagc
ggccgcgcggcaggctcggcggtcgtgctggcggcgagccgcggcaaggggctcgaagcc
gtcacgcaggaccgccccaaagtcatgctgccgattgccggcaagccgctgttgcgctgg
ctcgtcgacgcgttcaagaagcagggcgtcaacgacatcacggtggtcggcggctatcgc
gccgacgccatcgatacagcgggcatcaagctcgtcgtcaatgaaaagcatgccgagacg
ggcgaactcgcgtcgctcgcgtgcgcgctggacaagctctcgggcgatgccgtcatttcc
tacggcgacctgctgttccgcagctatatcctgcgcgatctggtggaaagcgaggcggcg
ttcagcgtagtggtcgattcctcgctgaccgacgcggaaaatgcgagcgtgcgcgacttc
gcgtggtgctcggccgccgacgaccgggggctcttcggcaacaaggttctgctgcgccat
gtgtcgagcggacaggaggcgtcgtcggcgatcgcctcgcaagcgccgcatggccgctgg
gtcggcctcctgaatgtgcgcggcgaaggccgcgagcgtctgcaggcggtcatgcgccag
ttgcaggcgcgcgccgatttcgcgtcgctcgatatgcccgcgttgctcaacgcgctgatc
gaagcaggcgaatccatcgaagtgcagtatgtgcacggccactggcgcggcgtcaacgac
ctcgaagacttccgccgcgcgggcgacttcgcgcacggccagacgccgctcgcggcgtct
gtcggcggtgcgggctccgacatggcgaatggagcggcgcaatga

DBGET integrated database retrieval system