KEGG   Paraburkholderia phenoliruptrix: BUPH_06165Help
Entry
BUPH_06165        CDS       T02300                                 

Definition
(GenBank) 2-dehydro-3-deoxyglucarate aldolase
  KO
K01630  2-dehydro-3-deoxyglucarate aldolase [EC:4.1.2.20]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00053  Ascorbate and aldarate metabolism
bpx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    BUPH_06165
Enzymes [BR:bpx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.20  2-dehydro-3-deoxyglucarate aldolase
     BUPH_06165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI PK
Motif
Other DBs
NCBI-ProteinID: AFT89588
UniProt: K0DZN9
LinkDB All DBs
Position
2:complement(2288939..2289745)
Genome map
AA seq 268 aa AA seqDB search
MPAAPCPPYQSFPNSFRHAVRSGETLVGCWASLASPIVTELLGVIGFDWMLLDAEHAPND
VLTLIPQLMALKDSRSAPVVRPPANDSVVIKRLLDSGFANFLVPFVDNADAAARAVAATR
YPPQGVRGVSVGHRGNRYATVPDYFDMANDNVCVIVQIESRQAVESIDAILAVDGVDAVF
VGPSDLAAAYGHLGNAAHPDVQQAIAHVFERAQAAGKPSGILAPVQADAERYLAMGCRVI
AVCADLGLLRNAAQAVHQHFIKKPADPS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgccagccgcgccctgcccgccttatcagtcttttcccaacagcttccgccacgcggta
cgcagcggcgaaacgctggtcggctgctgggcctcgctcgcgagtccgatcgtcacggaa
ctgctcggcgtgatcggcttcgactggatgctgctcgacgcggagcatgcgcccaacgac
gtcctcacactgatcccgcaactgatggcgctcaaggatagccgaagcgcgccggtggtg
cgcccgccggccaatgacagcgtggtcatcaaacggctgctcgacagcggctttgcaaat
ttcctcgtgccgtttgtcgataacgccgacgccgcggcgcgcgcggtcgccgccacgcgc
tatccgccgcagggcgttcgcggcgtgtcggtgggccaccgcggcaaccgctacgcgacg
gtacccgactattttgacatggccaacgacaacgtctgcgtcatcgtgcagatagaaagc
cgccaagccgtggagtcgatcgacgcgattctcgccgtcgacggcgtcgatgccgttttc
gtcggcccatccgacctcgcggcggcttatgggcatctcggcaacgccgcgcacccggac
gtccagcaggccatcgcgcatgtgttcgaacgtgcgcaggccgcaggcaagccgagcggc
attcttgcaccggtgcaagccgacgccgaacggtatctcgcgatgggctgtcgcgtcatc
gccgtatgcgccgatctcgggctgttgcggaacgcggcgcaggcggttcatcaacacttc
atcaagaaaccggcggatccgagctga

DBGET integrated database retrieval system