KEGG   Paraburkholderia phenoliruptrix: BUPH_06765Help
Entry
BUPH_06765        CDS       T02300                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00020  Citrate cycle (TCA cycle)
bpx00190  Oxidative phosphorylation
bpx00650  Butanoate metabolism
bpx01100  Metabolic pathways
bpx01110  Biosynthesis of secondary metabolites
bpx01120  Microbial metabolism in diverse environments
bpx01130  Biosynthesis of antibiotics
bpx01200  Carbon metabolism
Module
bpx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bpx_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BUPH_06765
   00650 Butanoate metabolism
    BUPH_06765
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BUPH_06765
Enzymes [BR:bpx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BUPH_06765
    1.3.5.4  fumarate reductase (quinol)
     BUPH_06765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 FAD_binding_3 Pyr_redox_2 DAO GIDA HI0933_like FAD_oxidored Pyr_redox_3 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AFT88987
UniProt: K0DW93
LinkDB All DBs
Position
2:complement(1591793..1593568)
Genome map
AA seq 591 aa AA seqDB search
MAAIKNALPRRKFDVVIVGAGGSGMRASLQLARAGLSVCVLSKVFPTRSHTVAAQGGIGA
SLGNMSEDNWHYHFYDTIKGSDWLGDQDAIEFMCREAPNAVYELEHFGMPFDRNADGTIY
QRPFGGHTANYGEKPVQRACAAADRTGHALLHTLYQQNVAAKTQFFVEWMALDLIRDADG
DVLGVTALEMETGDVYILEGKTTLFATGGAGRIFAASTNAFINTGDGLGMAARAGIALQD
MEFWQFHPTGVAGAGVLITEGVRGEGGILRNSNGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGVGPNKDHVLLDLSHIGAETIMKRLPSIREIALKFANVDCIKEPIPVVPTIHYQ
MGGIPTNINGQVVGTPRGHEEVVNGFYAVGECSCVSVHGANRLGTNSLLDLVVFGRAAGN
HIVKHVKELKEHKPLPADAADFALSRLAKLESSSSGEYAQSVANDIRGTMQKHAGVFRTS
ALLAEGVEAIREVAARVENIHLKDKSKVFNTARVEALEVANLIEVARATMVSAEARKESR
GAHAQNDFEHRDDENWLRHTLWFSEGDRLDYKPVHMQPLTVESVPPKARTF
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaatcaagaatgccctgccgcgtcgcaagttcgacgtggtcatcgtcggcgcg
ggcggctcggggatgcgcgcgtcgctgcaactggcgcgcgcgggtctgtcggtgtgcgtg
ctctcgaaagtgtttcccacgcgctcgcatacggtggccgcgcaaggcggcatcggcgcc
tcgcttggcaacatgagcgaggacaactggcactaccacttctacgacacgatcaagggc
tccgactggctcggcgaccaggacgcgatcgaattcatgtgccgcgaagcgccgaacgcc
gtgtacgagctcgagcacttcggcatgccgttcgaccgcaacgccgacggcacgatctac
cagcgcccgttcggcggccacacggccaattacggcgaaaagcccgtgcagcgcgcctgc
gcagcggctgaccgcaccggccacgcgctgctgcacacgctctaccagcagaacgttgcg
gcgaagacgcagttcttcgtcgagtggatggcgctcgatctgatccgcgacgccgacggc
gacgtgctcggcgtgaccgcgctcgaaatggaaacgggcgacgtctacattctcgaaggc
aagaccacgctgttcgccacgggcggcgcgggccgcatcttcgcggcctcgaccaacgcg
ttcatcaacaccggcgacggtctgggcatggccgcgcgcgcaggcatcgcgctgcaggac
atggagttctggcagttccacccgacgggcgtggccggcgcgggcgtgctgattaccgaa
ggcgtgcgcggcgaaggcggcattctgcgcaactccaacggcgagcgcttcatggagcgc
tatgcgccgacgctgaaggatctggcgccgcgcgacttcgtctcgcgctcgatggaccag
gaaatcaaggaaggccgcggcgtgggcccgaacaaggaccacgtgctgctcgatctgtcg
cacatcggcgccgagacgatcatgaagcggctgccgtcgatccgcgagatcgcgctgaag
ttcgcgaacgtcgactgcatcaaggagccgattccggtcgtgccgaccatccactaccag
atgggcggcattccgacgaacatcaacggccaggtggtgggcacgccgcgcggccacgaa
gaggtcgtcaacggcttctacgcggtgggcgagtgctcgtgcgtgtcggtgcacggcgcg
aaccgtctgggcacgaactcgctgctcgatctggtggtgttcggccgcgcggcgggcaac
catatcgtcaagcacgtgaaggagctgaaggagcacaagccgttgccggcggatgcggcg
gacttcgcgctctcgcgtctggcgaagctggagagctcgtcctcgggcgagtacgcgcag
agcgtggccaacgacatccgcggcacgatgcagaagcacgcgggcgtgttccgcacgtcg
gcgctgctcgccgaaggtgtcgaggcgatccgcgaagtggcggcgcgggtggagaacatc
cacctgaaggacaagtcgaaggtgttcaacaccgcgcgggtcgaggcgctggaggtggcg
aacctgatcgaggtggcgcgcgcgacgatggtctcggccgaggcgcgcaaggaaagccgc
ggcgcgcacgcgcagaacgacttcgagcatcgcgacgacgagaactggctgcgccatacg
ttgtggttcagcgagggcgaccgcctcgactacaagccggtgcacatgcagccgctgacg
gtcgaatcggtgccgcccaaggcgcggaccttctaa

DBGET integrated database retrieval system