KEGG   Paraburkholderia phenoliruptrix: BUPH_06768Help
Entry
BUPH_06768        CDS       T02300                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00020  Citrate cycle (TCA cycle)
bpx00190  Oxidative phosphorylation
bpx00650  Butanoate metabolism
bpx01100  Metabolic pathways
bpx01110  Biosynthesis of secondary metabolites
bpx01120  Microbial metabolism in diverse environments
bpx01130  Biosynthesis of antibiotics
bpx01200  Carbon metabolism
Module
bpx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bpx_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BUPH_06768
   00650 Butanoate metabolism
    BUPH_06768
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BUPH_06768
Enzymes [BR:bpx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BUPH_06768
    1.3.5.4  fumarate reductase (quinol)
     BUPH_06768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4_7 Fer4_18 Fer4_4 Fer4 Fer2
Motif
Other DBs
NCBI-ProteinID: AFT88986
UniProt: K0DS68
LinkDB All DBs
Position
2:complement(1591064..1591768)
Genome map
AA seq 234 aa AA seqDB search
MAKRTFEIYRYDPDRDEAPRMQTYEIEIDSHERMLLDALVKLKALDETLSFRRSCREGVC
GSDAMNINGKNGLACLTNLNDLPQKIVLRPLPGLPVVRDLICDFTQFFNQYHSIRPYLIN
DTPPPEKERLQSPEERDELDGLYECILCASCSTSCPSFWWNPDKFVGPAGLLQAYRFIAD
SRDQATGERLDNLEDPYRLFRCHTIMNCVDVCPKGLNPTKAIGKIKELMVRRTV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcgtacatttgaaatctaccgctacgatccggaccgggacgaggcaccgcgc
atgcagacgtacgagatcgagatcgactcgcacgagcgcatgctgctcgacgcgctggtg
aagctcaaggcgctggacgagacgctgtcgttccgccgctcatgccgcgagggcgtatgc
ggctcggacgcgatgaacatcaacggcaagaacggtctggcgtgtctgacgaacctgaac
gacctgccgcagaagatcgtgctgcgtccgctgccggggctgcccgtggtgcgcgacctg
atctgcgacttcacgcagttcttcaaccagtatcactcgatcaggccgtacctgatcaac
gacacgccgccgccggagaaggagcgtctgcagtcgccggaggaacgcgacgagctcgac
gggctttacgagtgcattctgtgcgcgagctgctcgacgtcgtgcccgagcttctggtgg
aacccggacaagttcgtgggcccggcgggtctgctgcaggcgtaccgcttcatcgcggac
agccgcgatcaggccacgggcgagcggctcgataacctggaagatccgtaccggctgttc
cgctgccataccatcatgaactgcgtcgacgtctgcccgaaggggctgaacccgaccaag
gcgatcggcaagatcaaggaattgatggttcgccgcactgtttga

DBGET integrated database retrieval system