KEGG   Paraburkholderia phenoliruptrix: BUPH_06769Help
Entry
BUPH_06769        CDS       T02300                                 

Definition
(GenBank) Succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00020  Citrate cycle (TCA cycle)
bpx00190  Oxidative phosphorylation
bpx00650  Butanoate metabolism
bpx01100  Metabolic pathways
bpx01110  Biosynthesis of secondary metabolites
bpx01120  Microbial metabolism in diverse environments
bpx01130  Biosynthesis of antibiotics
bpx01200  Carbon metabolism
Module
bpx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bpx_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BUPH_06769
   00650 Butanoate metabolism
    BUPH_06769
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BUPH_06769
Enzymes [BR:bpx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BUPH_06769
    1.3.5.4  fumarate reductase (quinol)
     BUPH_06769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer2
Motif
Other DBs
NCBI-ProteinID: AFT88904
UniProt: K0DZX6
LinkDB All DBs
Position
2:1492063..1492680
Genome map
AA seq 205 aa AA seqDB search
MAKRTFEIYRYDPDRDAAPRMQTYEIEIDSHERMLLDALVKLKALDETLSFRRSCREGVC
GSDAMNINGKNGLACLTNLNDLPQKIVLRPLPGLPVVRDLICDFTQFFNQYHSIRPYLIN
DTPPPEKERLQSPEERDELDGFTSAFCARAARRRARASGGTRTSSWARRVCCRRIASSRT
AAIRPRASGSITWKIRTGCSAAIPS
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcgtacatttgaaatctaccgctacgatccggaccgggacgcggcaccgcgc
atgcagacgtatgagatcgagatcgactcgcacgagcgcatgctgctcgacgcgctggtg
aagctcaaggcgctggacgagacgctgtcgttccgccgctcatgccgcgagggcgtatgc
ggctcggacgcgatgaacatcaacggcaagaacggtctggcgtgtctgacgaacctgaac
gacctgccgcagaagatcgtgctgcgtccgctgccggggctgcccgtggtgcgcgacctg
atctgcgacttcacgcagttcttcaaccagtatcactcgatcaggccgtacctgatcaac
gacacgccgccgccggagaaggagcgtctgcagtcgccggaggaacgcgacgagctcgac
ggctttacgagtgcattctgtgcgcgagctgctcgacgtcgtgcccgagcttctggtgga
acccggacaagttcgtgggcccggcgggtctgctgcaggcgtatcgcttcatcgcggaca
gccgcgatcaggccacgggcgagcggctcgataacctggaagatccgtaccggctgttcc
gctgccataccatcatga

DBGET integrated database retrieval system