KEGG   Paraburkholderia phytofirmans: Bphyt_0024Help
Entry
Bphyt_0024        CDS       T00765                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy00010  Glycolysis / Gluconeogenesis
bpy00620  Pyruvate metabolism
bpy01100  Metabolic pathways
bpy01110  Biosynthesis of secondary metabolites
bpy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bphyt_0024
   00620 Pyruvate metabolism
    Bphyt_0024
Enzymes [BR:bpy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Bphyt_0024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ACD14476
UniProt: B2SZ97
LinkDB All DBs
Position
1:complement(34086..35606)
Genome map
AA seq 506 aa AA seqDB search
MNHAEMQFLTTEFPYKKQYANFIGGEWVKPVGGEYFDNVSPITGEAFTSIPRSREADVEL
ALDAAHRAKAAWGKTSAGDRSNILMRIADRMEANLQRLAVAETIDNGKPLRETMAADIPL
AIDHFRYFAGAVRAQEGSISEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPALA
AGNCVVLKPAEQTPASILVLVELIQDLLPAGVLNVVNGFGLEAGKPLASSKRIAKIAFTG
ETTTGRLIMQYASQNIIPVTLELGGKSPNIFFDDVMNADDSYFDKALEGFAMFALNQGEV
CTCPSRVLIDEKIYDRFMERALKRVAAITQGHPLDTRTMIGAQASQEQLEKILSYVDLGK
QEGAECLIGGERNALDGELSKGYYVKPTVFRGHNKMRIFQEEIFGPVVSVTTFKTEEEAL
EVANDTLYGLGAGVWTRDGTRAYRFGRQIQAGRVWTNCYHAYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYSDKPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgcagagatgcaatttctgaccaccgaattcccgtacaagaagcagtatgcg
aattttatcggcggcgaatgggtaaagcctgtaggcggcgagtacttcgacaacgtgtcg
ccgatcaccggtgaagctttcacgtcgatcccacgttcgcgcgaagccgacgtcgaactc
gcgctcgatgcggcgcaccgtgcgaaagccgcgtggggaaaaacctccgccggcgaccgg
tcgaatattctgatgcgcattgccgaccggatggaagcgaacctgcaacgtctcgccgtg
gccgagacgatcgacaacggcaagccgctacgcgaaaccatggccgccgacattccgctc
gcgatcgatcacttccgctacttcgccggcgccgtgcgtgcgcaggaaggctcgatctcc
gagatcgatcacgataccgtcgcctatcactttcatgaaccgctcggcgtggtcggccag
atcattccgtggaatttcccgatcctgatggccgtatggaagctcgcgcccgcactcgct
gccggcaactgcgtggtgctcaagccggccgagcaaacgcccgcttcgattctcgtcctc
gtcgaactgattcaggacctgttgcccgcgggcgtgctgaacgtggtgaacggcttcggt
ctcgaagccggcaagccgctcgcttccagcaagcgcatcgccaagatcgcgtttaccggc
gagaccacgaccggccgtctgatcatgcagtacgcgagccagaacatcattccggtgacg
ctcgagctcggcggcaagagcccgaatattttcttcgacgacgtgatgaacgccgacgac
agctatttcgacaaagcgctcgaaggcttcgcgatgttcgcgctgaatcagggcgaagtg
tgcacgtgtccgtcgcgcgtattgatcgatgaaaagatctacgaccgcttcatggaacgt
gcgctcaagcgcgtcgcggcgatcacgcaaggccatccgctcgacaccaggacgatgatc
ggcgcgcaggcctcgcaagagcagctggaaaagatcctctcgtatgtcgacctcggcaaa
caggaaggcgccgaatgcctgatcggcggtgaacgcaatgcgctcgacggtgaattgagc
aaaggctattacgtgaagccgactgtgttccgcggccacaacaagatgcgcatcttccag
gaagaaatcttcgggccggtggtgtcggtcacgacgttcaagaccgaagaagaagcgctc
gaggtcgccaacgatacgctttacggtctcggcgccggcgtatggacgcgcgacggtacg
cgcgcctatcgcttcggccggcagattcaggcaggccgcgtgtggaccaactgctatcac
gcctatccggcgcatgcggcattcggtggctacaagcaatcaggcatcggacgggagaat
cacaagatgatgctcgaccactatcagcagaccaagaatctgctggtcagctatagcgac
aagccgctcggtttcttctaa

DBGET integrated database retrieval system