KEGG   Paraburkholderia phytofirmans: Bphyt_0328Help
Entry
Bphyt_0328        CDS       T00765                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy00970  Aminoacyl-tRNA biosynthesis
bpy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpy00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Bphyt_0328
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bpy03029]
    Bphyt_0328
Enzymes [BR:bpy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Bphyt_0328
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Bphyt_0328
Mitochondrial biogenesis [BR:bpy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Bphyt_0328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ACD14753
UniProt: B2T1M4
LinkDB All DBs
Position
1:353443..354930
Genome map
AA seq 495 aa AA seqDB search
MHEKSLTELRAALTAKECSAVELAQLYLKRIDAANSLNAFIQVDPDLTLAQAKAADALLH
TGHAGPLVGLPIAHKDVFVTKGWRSTAGSKMLSNYESPFDATVVARLQNAGMVCVGKTNM
DEFAMGSSNENSYFGPVQNPWDVKAVPGGSSGGSAAAVAARLAPAATGTDTGGSIRQPAS
FSGITGIKPTYGRVSRYGMIAFASSLDQGGPMAQSAADCATLLNAMAGFDERDSTSLVRD
DEDYTRYLGKPWKEESAAKPLAGLRIGLPKEYFGAGLADDVRASVDAALKQYEALGATLV
DVSLPKTELSIPVYYVIAPAEASSNLSRFDGVRFGHRAAEYRDLLDMYKKSRAEGFGPEV
KRRILVGAYVLSHGYYDAYYLQAQKIRRIIAQDFQEAFKQCDVIMGPVAPSVAWDLGAKG
DDPVQMYLADIYTLSVSLAGLPGMSVPCGFGAGANAQRPVGLQIIGNYFNEARMLQVADA
FQRATDWHRKAPAGV
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaaaaaagtttgaccgaactgcgcgccgcactgacggccaaggaatgctccgca
gtcgaactggcgcagctctatctgaagcggatcgatgcggccaacagcctgaacgcgttc
atccaggtcgacccggatctgacgctcgcgcaggcgaaagccgcggacgcgctgcttcat
accggccacgcgggcccgctggtcggcctgccgatcgcacacaaagacgtgttcgtgacc
aagggctggcgctccaccgccggctcgaaaatgctgtcgaactacgagagcccgttcgac
gcgaccgtggtcgcgcgtctgcaaaacgccggcatggtgtgcgtcggcaagaccaatatg
gatgagttcgcaatgggctcatccaacgagaattcgtactttggtcccgtgcagaatccg
tgggatgttaaggccgtgccgggcggttcatcgggcgggtcggctgcggccgtcgccgcg
cgcctcgcgcccgctgcaacgggtacggataccggcggctcgattcgtcagccggcgtcg
ttctccggcatcacgggtatcaagccgacgtatggtcgcgtgtcgcgttacggcatgatc
gcgtttgcctcgtcgctggatcagggcggcccgatggcgcaaagcgccgcggattgcgcc
acgctgctcaacgccatggccggtttcgacgagcgcgattcgactagcctcgtgcgcgac
gacgaagactacacgcgttatctcggcaagccatggaaagaagagagcgccgccaaaccg
ctcgccggcttgcgcatcggcctgccgaaagagtatttcggcgccggtctcgccgacgac
gtgcgcgcctcggtcgacgccgcgttaaagcaatacgaagcgctcggcgccacgctcgtc
gatgtctcgctgccgaaaaccgagctgtcgattcccgtgtattacgtgatcgcgccggcg
gaagcttcgtcgaacctgtcgcgtttcgacggcgtgcgcttcggtcatcgcgcggcggag
tatcgcgatctgctggacatgtacaagaagtcgcgcgccgaaggtttcggtccggaagtg
aagcgccgtattctggtcggcgcctacgtgctgtctcatggctattacgacgcgtactac
ctgcaggcgcagaagatccgccgcatcatcgcgcaggacttccaggaagcgttcaagcag
tgcgacgtgatcatgggcccggttgcgccgtcggtggcgtgggacctcggcgcgaagggc
gacgatccggtgcagatgtatctggccgacatctacacgctgtcggtgagcctcgccggt
ttgccgggcatgagcgtgccgtgcggcttcggtgcgggcgcgaatgcgcagcgtccggtt
ggattgcagatcatcggcaactatttcaacgaagcccggatgctccaggtggccgacgcg
ttccagcgcgcgaccgactggcaccgcaaagcaccggcaggagtgtga

DBGET integrated database retrieval system