KEGG   Paraburkholderia phytofirmans: Bphyt_1372Help
Entry
Bphyt_1372        CDS       T00765                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bpy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Bphyt_1372
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpy02000]
    Bphyt_1372
Enzymes [BR:bpy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Bphyt_1372
Transporters [BR:bpy02000]
 Other Transporters
  Pores ion channels [TC:1]
   Bphyt_1372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 Tom37 GST_N_4
Motif
Other DBs
NCBI-ProteinID: ACD15787
UniProt: B2T2H6
LinkDB All DBs
Position
1:1531032..1531679
Genome map
AA seq 215 aa AA seqDB search
MIKLCGFALSNYYNKVKFVLLEHGIPFEEVSVKPSQDEAMLEHSPLGKVPYLQTEDGDLS
ESQCIVEYLAARFPDKAIFAADPWEAAKERELIMFVDVHLELTVRNLYKEAFFGGIVTEA
TKGRVEKLLRHHIAGFKRIAKFGPYLRGERFSVADTAGYVSLPLVGMATQTIYGSDFLLD
AGIDWKSYVKAVNVRPAAQRVTEDRKAYIAASRPT
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagctgtgcggtttcgcgctctctaactattacaacaaagtgaagttcgtgctg
ctcgaacacggcattccgttcgaggaagtgtccgtgaaacccagccaggacgaggccatg
ctcgagcattcgccgctcggcaaagtgccttatcttcaaactgaagacggcgatctgagc
gaatcgcaatgcattgtcgagtatctggcggcgcgttttcccgataaggcgattttcgcc
gccgacccgtgggaagcggccaaggagcgcgaactgatcatgttcgtcgacgtgcatctc
gaactgactgtgcgcaatctctacaaggaggcattctttggcggcatcgtgaccgaggcg
accaaagggcgcgtcgagaaactgctcaggcatcacattgccggcttcaaacggatcgcg
aagttcgggccgtatctgaggggcgagcgcttcagcgtcgcggatacggccggctatgtg
agcttgccgctggtgggcatggcgacgcagaccatctacggcagcgattttctgctcgac
gccggaatcgattggaagagctatgtgaaagcggtcaacgtgaggccggccgcgcagcgt
gtgaccgaggaccgcaaggcgtatatcgcggcgtcgcgcccgacttga

DBGET integrated database retrieval system