KEGG   Paraburkholderia phytofirmans: Bphyt_1858Help
Entry
Bphyt_1858        CDS       T00765                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bpy00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Bphyt_1858
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bpy03400]
    Bphyt_1858
Enzymes [BR:bpy01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Bphyt_1858
DNA repair and recombination proteins [BR:bpy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Bphyt_1858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S Pol_alpha_B_N
Motif
Other DBs
NCBI-ProteinID: ACD16266
UniProt: B2T3V5
LinkDB All DBs
Position
1:2085683..2088505
Genome map
AA seq 940 aa AA seqDB search
MNDRLDLYNRKRRFDDTPEPAGTRARRKPAGRKTTRQAAGEALSYVIQEHDARRLHYDFR
LELNGTLLSWAVPKGPSLDPSVKRLAVHVEDHPVEYGSFEGEIPPGNYGAGSVIVWDRGT
WEPVGGAAEAARSYAAGKLKFHLHGEKLHGGWTLVRSHMRGSGDKEQWLLIKERDDEARD
ESDYDILKKRPGSVLSGSASVAKGEKTTTAASKTARKTAASDAKSTAKRGGKSSAKAASS
TRADPRRPDIVATRNTQSLRELAATPSIEGAVKARLPTTFKPQLATLVDAAPPGDEWSYE
IKFDGYRVLARIDRDAKGSAVKVFTRAGNDWTAKFSKQVKAFEQLGIESAWLDGEAVVLD
PNGVPNFQALQNAFDANRPQDIIVYLFDIPFLNGYDLRGVPLEQRRAILHALMEDVDDSV
LRFSNNFDFSAEDLLRSACDMALEGIIGKRRDSGYLSGRSSTWIKLKCRRRQEFVIGGYS
EPSGSRAAFGALLLGVYDSKGNLNYAGRVGTGFDAALLRSVKKELDAHATKRMPFAAVPR
ERSRTPVHWVEPVLVAECNFAEWTSDGIVRQASFVSLRNDKPARQIVKETPRQGADVQQQ
TDSISDDAPKKRAARKTSGSNVAAAGKTTAAKPKTAKSPTTAPPAEVAGVRISHPDRVID
KSSGARKIDLVQYYESVAEWMLPHLKDRPVSLVRAPEDIGGELFFQKHSQKLSIPNVTQH
PGLDPGHPPLITVDTIKALVGAAQMGTVEFHTWNAVASNIEKPDRAVFDLDPDAALGWER
MIEAAQLTRSLLEELGLTSFCKTSGGKGLHVVVPLAKQAGWDEVKDFSQAVAQHMAATLP
KYFSAKMGAQNRKQKIFVDYLRNNRGSSTVAAFSARARPGLGVSVPLAWDEVAGTTGGDQ
WTIENLHERLAELKSDPWADYAKTRQRITAAMKKRLNDAQ
NT seq 2823 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaccgactcgatctctacaaccgcaagcgccgcttcgacgacacgccggagccg
gcgggcacgcgcgccaggcgcaaaccagccggccggaaaacgacccgccaggcagccggc
gaggcgctctcatacgtgatccaggaacacgacgcccggcgcttgcactacgacttccgg
ctggaactgaacggcacactcctgtcgtgggcggtgcccaaagggccgagcctcgatccc
tcggtgaaaaggctggcagtgcatgtcgaggatcatccggtcgaatacggttcgttcgaa
ggggaaatcccgcccggcaactacggtgcgggcagcgtgatcgtgtgggatcgcggcacc
tgggaaccggttggcggcgcggcggaggcggcgcgttcctacgcggccggcaaactcaag
ttccatttgcacggcgaaaagctgcacggcggctggacactggtgcgcagccatatgcgc
ggcagcggcgacaaggagcagtggctgctgatcaaggaacgcgacgacgaagcgcgcgat
gagagcgactacgacattctgaagaagcgcccgggcagcgtgctcagcggcagcgcctcg
gtggctaaaggcgaaaaaacgacgacagcggcatctaagaccgcgcgcaaaaccgcggcc
tctgatgcgaagtccaccgcaaaacgaggcggcaaaagcagcgcgaaagccgcttcatcc
acccgcgcggatcccagacgaccggatatcgtggcgacgcgcaacacgcagtcgctacgc
gaactcgccgccacgccctcgatcgagggcgcggtgaaagctcgcttgcccacgaccttc
aaaccgcaactggcgacgctcgtcgacgccgcgccgcccggcgacgaatggtcgtacgaa
atcaagttcgacggttaccgcgtgctggcccgaatcgatcgggacgcgaaggggagcgcc
gtcaaagtattcacccgcgccggcaacgactggaccgcgaaattcagcaaacaggtcaag
gcgttcgaacagctcggaatcgaaagcgcgtggctcgacggcgaagccgtggtgctggac
ccgaacggcgtgccgaattttcaggcgctgcagaacgctttcgatgcgaaccggccgcaa
gacatcatcgtctacctgttcgatataccgttcctgaacggctacgacctgcgcggcgtg
ccgctcgaacagcgtcgcgcgattctgcacgctctgatggaagacgtcgacgatagcgtg
ctgcgtttctcgaacaatttcgacttcagcgcggaagacctgctcagaagcgcgtgcgac
atggcgctggaaggcatcatcggcaagcggcgcgatagcggctatctgtcgggccgttcg
tcgacgtggatcaagttgaaatgccgccggcgtcaggagttcgtgataggcggctattcg
gaaccgtccggaagtcgtgcggcattcggcgcgctgctgctcggcgtctacgacagcaaa
ggcaatttgaattacgcggggcgcgtcggcaccggcttcgacgcggcgttgctgcgctcg
gtcaagaaagaactcgacgcgcacgcgaccaagcgcatgccgtttgcggccgtgccgcgc
gagcgcagccgcacgccggtgcattgggtcgaaccggtgctcgtagccgaatgcaatttc
gcggaatggacgagtgacggcatcgtgcgtcaggcgtcgttcgtgagtttgcgcaatgac
aagccggcgcgccagatcgtcaaggaaacacctcgccagggagccgacgtgcaacagcaa
accgattccatctccgacgacgcgccgaagaaacgcgcggcgcggaaaacttctggtagt
aacgtggccgcagccggaaaaaccacagccgccaaacccaaaaccgcaaaatcacccacc
accgcaccgcccgccgaagtcgccggcgtgcgcatctcgcatcccgatcgcgtcatcgac
aaaagcagcggtgcgcgcaagatcgatctcgtgcagtactacgagtcggtggccgaatgg
atgctgccacatctgaaagaccgtccggtgtcgctggtgcgtgcgcccgaggacatcggc
ggcgagctgttttttcagaagcacagccagaagctgtcgattccaaatgtcacgcagcat
ccgggcctcgatcccggtcatccgccactgatcaccgtcgataccatcaaggcgctggtc
ggcgcggcgcaaatgggcaccgtcgaatttcacacgtggaatgcggtcgcatcgaatatc
gaaaaaccggaccgcgcagtcttcgacctagaccccgatgcagcgctaggttgggaacgc
atgatcgaagccgcgcaactgacgcgttcgctgctcgaggaactcggcctcacatcgttc
tgcaagacgagcggcggcaagggcttgcatgtggtcgtgccgctcgcgaaacaggccggc
tgggacgaagtaaaggacttttcgcaagccgtcgcgcagcatatggctgcgacgctgccc
aagtacttcagcgcgaagatgggcgcgcagaaccgcaagcagaaaatcttcgtcgactat
ctgcgcaacaaccgcggctccagcacagtcgccgcattttcggcgcgggcgcgtccgggc
ctcggtgtatcggttccgcttgcgtgggacgaagtcgccggcaccacgggcggcgatcaa
tggaccatcgagaatctgcacgagcgcctcgccgaactcaaaagcgacccgtgggcggac
tatgcaaagacgcgtcagcgcatcaccgcggccatgaaaaaacgtctgaatgacgcgcaa
taa

DBGET integrated database retrieval system