KEGG   Paraburkholderia phytofirmans: Bphyt_3233Help
Entry
Bphyt_3233        CDS       T00765                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
bpy  Paraburkholderia phytofirmans
Brite
KEGG Orthology (KO) [BR:bpy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bphyt_3233
Enzymes [BR:bpy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     Bphyt_3233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ACD17624
UniProt: B2SY89
LinkDB All DBs
Position
1:complement(3641381..3642478)
Genome map
AA seq 365 aa AA seqDB search
MTTQSTDHDQQNMTAIVCHAPKDYRVEQVSKPRAGAHELVIRIAACGICASDCKCHSGAK
MFWGGPSPWVKAPVIPGHEFFGFVEEIGEGAADHFGVKMGDRVIAEQIVPCGKCRYCKSG
QYWMCEVHNIFGFQREVADGGMAEYMRIPPTAIVHKIPDGISLEDAAIIEPLACAIHTVN
RGEVQLDDVVVIAGAGPLGLMMTQIAHLKTPKKLVVIDLVEERLALAREYGADVTINPKQ
DDALAIIHSLTDGYGCDVYIETTGAPIGVNQGMDLIRKLGRFVEFSVFGADTTLDWSVIG
DRKELDVRGAHLGPYCYPIAIDLLARGLVTSKGIVTHGFSLEEWDEAIKIANSLDSIKVL
LKPRA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgacgactcaatccacagaccacgatcagcagaacatgacagccatcgtctgtcatgca
ccgaaagactatcgcgtcgaacaggtgtcgaaacctcgcgcgggtgcgcacgaactggtg
atccgcattgccgcgtgtgggatttgcgcgagcgactgcaaatgtcattcgggcgcgaag
atgttctggggcggcccgagcccgtgggtgaaagcgccggtgattccgggtcacgagttc
tttggtttcgtggaagaaatcggcgaaggcgcggccgatcacttcggcgtgaaaatgggt
gaccgcgtgatcgccgaacagatcgtgccgtgcggcaaatgccgctattgcaaatccggc
cagtactggatgtgcgaggtgcacaacatcttcggcttccagcgcgaagtcgccgatgga
ggcatggccgaatacatgcgcattccgccgacggcgattgtccacaagattcccgacggc
atttcgctggaagacgccgcgatcatcgagccgctcgcctgcgcgatccacacggtcaat
cgtggcgaagtgcaactcgacgatgtcgtggtgatcgccggcgccggtccgctcggtttg
atgatgacgcaaatcgcgcatctgaaaacgccgaagaaactggtggtgatcgatctcgtc
gaagagcgccttgcgctcgcccgcgagtacggcgccgacgtgacgatcaacccgaaacag
gacgacgcgctggcgatcatccattcgctcacggacggttacggctgcgatgtgtatatt
gaaaccacgggtgcgccgatcggcgtgaatcagggcatggacctgattcgcaagctcggg
cgcttcgtcgagttttcggtgttcggcgcggatacgacgctggattggtcggtgatcggc
gatcgcaaggaactcgacgtgcgcggcgcgcatctcggaccgtattgctatccgattgcg
atcgatctgctggcgcgcgggctggttacatcgaaaggcattgtcacgcacggcttttcg
ctggaagaatgggacgaggcgatcaagattgccaactcgctcgattcgatcaaggtgttg
ctgaagccgcgcgcctga

DBGET integrated database retrieval system