KEGG   Paraburkholderia phytofirmans: Bphyt_3646Help
Entry
Bphyt_3646        CDS       T00765                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bpy  Paraburkholderia phytofirmans
Brite
Translation factors [BR:bpy03012]
 Eukaryotic Type
  Elongation factors
   Bphyt_3646
 Prokaryotic Type
   Bphyt_3646
Mitochondrial biogenesis [BR:bpy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Bphyt_3646
Exosome [BR:bpy04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Bphyt_3646
  Exosomal proteins of breast cancer cells
   Bphyt_3646
  Exosomal proteins of colorectal cancer cells
   Bphyt_3646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW AAA_23 Lsm_C
Motif
Other DBs
NCBI-ProteinID: ACD18036
UniProt: B2T753
LinkDB All DBs
Position
1:complement(4075478..4076668)
Genome map
AA seq 396 aa AA seqDB search
MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLTQKFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIIKGSAKLALE
GDKGELGEVAIMNLADALDTYIPTPERAVDGAFLMPVEDVFSISGRGTVVTGRVERGVVK
VGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLAKPGS
INPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLINPIAMEEGLRFAIREGGRTVGAGVVAKILE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaggtaaattcgaacggaccaagccgcacgtgaacgtcggcacgatcggtcac
gttgaccacggcaagaccacgctgacggcagcgatcacgacggttctgacgcagaagttt
ggcggcgaagcgaaggcatacgaccagatcgacgcggcgccggaagaaaaggcacgtggt
atcacgatcaacacggcgcacgtcgagtacgaaacggctaaccgccactacgcacacgtc
gactgcccgggccacgctgactatgtgaagaacatgatcacgggcgcagcgcagatggac
ggcgcgatcctggtgtgctcggctgcagacggcccgatgccgcaaacgcgtgagcacatc
ctgctggcgcgtcaggttggcgtgccgtacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgctgagctgctcgaactcgtcgagatggaagtgcgcgaacttctgtcgaag
tacgacttcccgggcgacgacacgccgatcatcaagggttcggccaagctggcgctggaa
ggcgacaagggcgagctgggcgaagtggcgatcatgaatctggccgacgcgctggacacg
tacatcccgacgccggagcgcgcagttgacggtgcgttcctgatgccggtggaagacgtg
ttctcgatctcgggtcgcggcacggtggtgacgggtcgcgttgagcgcggcgtggtgaag
gtcggcgaggaaatcgaaattgtcggtatcaagccgacggtgaagacgacctgcacgggc
gtggaaatgttccgcaagctgctcgatcaaggtcaggcaggcgacaacgtgggtatcctg
ctgcgcggcacgaagcgtgaagacgtggagcgtggccaggttctggcgaagccgggttcg
atcaacccgcacacgcacttcacggctgaagtgtacgtgctgagcaaggacgaaggtggc
cgtcacacgccgttcttcaacaactatcgtccgcagttctacttccgtacgacggatgtg
acgggctcgatcgagttgccgaaggacaaggaaatggtcatgccgggcgacaacgtgtcg
atcacggtgaagctgatcaacccgatcgcgatggaagaaggtctgcgtttcgcaatccgc
gaaggcggtcgtacggtcggtgcaggtgtggttgccaagattctcgagtaa

DBGET integrated database retrieval system