KEGG   Paraburkholderia phytofirmans: Bphyt_4724Help
Entry
Bphyt_4724        CDS       T00765                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
bpy  Paraburkholderia phytofirmans
Brite
KEGG Orthology (KO) [BR:bpy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bphyt_4724
Enzymes [BR:bpy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     Bphyt_4724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Methyltransf_25 Methyltransf_11 Pyr_redox_2 PrmA MTS Methyltransf_31 ThiF Phosphonate-bd Methyltransf_24 Shikimate_DH Methyltransf_12 CMAS
Motif
Other DBs
NCBI-ProteinID: ACD19090
UniProt: B2TDQ0
LinkDB All DBs
Position
2:826689..827735
Genome map
AA seq 348 aa AA seqDB search
MLAAVLHEPKLIRIDEVDPPEPGPGEVRVRVRAGGICGSDLSYYFKGKSGDFAVREPFVL
GHEVAGEIDSLGEGVTAERRLAPGQRVAVNPGLACGTCRFCVGGMPNHCLNMRFMGSAST
FPHTQGMFRQYIVVAARQCVPVPDGVDFAQASMAEPLAVALHAVKQAGSLVGASVLLVGC
GPIGCILLSVARRAGAHRVVALDLSDRALQVARQLGADQTVNAAERAVIDQWSVQRGTFD
VVIEASGSPAGLDTALHAARAGGTVIQVGNLPAGQSPVAANLVMSKELRYQGSFRFTSEY
AIAADEIASGKVDLRPLMTHAFAMSEANRAFEVALDRSQSMKVHLNFD
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcagccgtgcttcacgaacccaaactgatccgcatcgacgaagtcgatccgcct
gaacccggtccaggcgaggtacgcgtgcgtgtacgcgccggcggcatttgcggctccgat
ctgtcgtactacttcaaaggcaagagcggcgatttcgccgtgcgtgagccgttcgtgctc
ggacatgaagtggcgggcgagatcgattcgctcggcgagggcgtgactgcggagcgtcgg
ctcgcgcccgggcagcgcgttgccgtcaatcctgggctggcctgcgggacgtgccgtttt
tgcgtcggggggatgccgaatcattgtctgaacatgcgcttcatgggcagtgcttctacg
ttcccgcatacgcagggcatgtttcgtcagtacatcgtcgtcgcggcgcgccaatgtgtg
cccgtgccggatggcgtcgatttcgcgcaggcgtcgatggccgagccgcttgccgttgcg
ttgcatgcggtgaagcaggccggatcgctggtcggcgcgagtgtcttgctggtgggttgc
gggccgatcggttgcattctgctgagcgtggcgcgccgggccggagcgcatcgcgtggtc
gcgttggatctctcagatcgagcgttgcaggtcgcgcggcaactcggcgcggatcagacc
gtcaacgccgcggagcgcgccgtgatcgatcaatggtccgtgcaacgcggcacgttcgac
gtggtcatcgaggcgtcgggcagtcccgccggcctcgatacggcgctgcatgcggcgcgc
gcgggcggcacggtgattcaggtgggcaacttgccggccggtcaatcgccggtggcggcg
aatctcgtgatgtcgaaagaactccgctatcaaggctcgttccgctttaccagcgaatat
gccatcgccgccgatgaaatcgcctcaggcaaagtcgacctgcggccgctgatgacgcat
gcgttcgcgatgagcgaagcaaaccgtgcgttcgaagtggcgctcgaccgctcgcagtcg
atgaaggtgcatctgaacttcgactga

DBGET integrated database retrieval system