KEGG   Paraburkholderia phytofirmans: Bphyt_5402Help
Entry
Bphyt_5402        CDS       T00765                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bpy  Paraburkholderia phytofirmans
Brite
KEGG Orthology (KO) [BR:bpy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bphyt_5402
Enzymes [BR:bpy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Bphyt_5402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like Glutaredoxin K_oxygenase Thi4 FAD_oxidored FAD_binding_3 DAO NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: ACD19760
UniProt: B2TBV8
LinkDB All DBs
Position
2:complement(1593063..1594655)
Genome map
AA seq 530 aa AA seqDB search
MLDANLKTQLKTYLEKVSRPIEIVASLDDSAKSQELLALLNDIATLSERVNVIERRGDAE
RKPSFSIGEPGKDTGIRFAGIPMGHEFTSLVLALLQVGGHPVKLEDAVIEQIRNLDGDYQ
FETYFSLSCQNCPEVVQALNVMALINPRIRHVAIDGALFQNEVEARQIMAVPTMFMNGEV
FGQGRSGVKEILAKLDTNAGARAAKELEKKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTLAIENFVSVTETEGPKFATALEQHVKTYEVDIMDVQRAEALIPGRINE
VRLANGAVLKAKTIILATGARWREINVPGEREYRNHGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGIVREVTLFEFGATLRADEVLQRKLRSLANVTVVTQAQTTEITGDGKKV
NGLVYKDLRSGEVKQIELEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLSAFDHLIRNSEEVEVVGEAEVAVAV
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatgccaatctcaagactcaattgaaaacgtacctcgaaaaggttagcaggcct
atcgagatcgtcgcgtcgctcgacgacagcgcaaaatcgcaagagctgctggcattgctg
aacgatatcgcgacgttgtcggagcgcgtcaacgtgatcgagcgtcgtggcgacgccgag
cgtaagccgtcgttttcgatcggcgagccgggcaaggacacgggcatccgtttcgccggc
attccgatgggtcatgaattcacgtcgctcgtgcttgcgttgttgcaggtgggcggtcat
ccggtcaagctcgaagatgccgtgatcgaacagatccgcaacctcgacggcgactatcaa
ttcgaaacgtatttttcgctgtcatgccagaactgcccggaagtcgtccaggcactgaac
gtgatggcgctgatcaacccgcgcatccgccacgtcgcgatcgacggcgcgctgttccag
aacgaagtcgaagcgcgccagatcatggcggtaccgaccatgttcatgaacggcgaagtg
ttcggccagggtcgcagcggcgtgaaggaaatcctcgcgaagctcgataccaacgccggt
gcgcgcgccgcgaaggaactggaaaagaagccagtgttcgatacgctgatcgtcggcggc
ggccctgcgggcgcggctgcggcgatctactcggcgcgcaagggtatcgcgacgggcgtg
gtggcggagcgcttcggcggtcaggtgctggacacgctggccatagaaaacttcgtctcc
gtgacggaaaccgaaggaccgaagttcgccacggcgctcgagcagcacgtgaagacttat
gaagtcgacatcatggacgtgcagcgtgctgaggcgctgatcccgggccgcatcaacgaa
gtgcgtctggcaaacggcgcggtgctcaaggccaaaacgatcattctggcgacgggcgca
cgctggcgcgaaatcaacgtgccgggcgagcgcgagtaccgtaatcatggcgtcgcgtac
tgcccgcactgcgacggtccgttgttcaagggcaagcgcgtcgcggtgatcggtggcggc
aattccggtgtcgaagcggcgatcgatctggcgggtatcgtgcgcgaagtgacgctgttc
gagttcggcgccacgctgcgcgctgacgaagtgctgcaacgcaagctgcgcagcctcgcg
aatgtgaccgtcgtcacgcaagcccaaaccacggaaatcaccggcgacggcaagaaggtc
aacggtctggtctacaaggatctgcgttcgggcgaagtgaagcagatcgaactggaaggc
gtgttcgtgcagatcggtctcgtgccgaacacggaatggctcaagggcacggtcgagttg
tcgaagcacggcgagatcgtcgtggatgcgcgcggcgcgacgtcggtgccgggcgtgttc
gccgccggcgacgtgaccacggtaccgttcaagcagatcgtgatcgccgtgggcgaaggc
gcgaaggcatcgctttccgcgttcgatcacctgatccgtaatagtgaagaagtggaagtg
gttggtgaagctgaggttgcagtagcggtttga

DBGET integrated database retrieval system