KEGG   Paraburkholderia phytofirmans: Bphyt_6822Help
Entry
Bphyt_6822        CDS       T00765                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy00500  Starch and sucrose metabolism
bpy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bphyt_6822
Enzymes [BR:bpy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Bphyt_6822
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Bphyt_6822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap APH hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ACD21115
UniProt: B2T9L3
LinkDB All DBs
Position
2:3162356..3165820
Genome map
AA seq 1154 aa AA seqDB search
MKRDDPAETTTQSPVGNAPGNTAKPRTNRRGKPAALSDDPLWYKDAIIYQVHIKSFFDAN
NDGVGDFPGLIAKLDYIAELGVNAIWLLPFYPSPRRDDGYDIADYRNVHPDYGNLSDVKR
FIQEAHARGIRVITELVINHTSDQHPWFQRARRAKPGSNHRNYYVWSDTDQKYQETRIIF
IDSEPSNWTHDPVAGAYYWHRFYSHQPDLNFDNPAVLKEVLQVMRFWLDMGIDGLRLDAV
PYLVEREGTNNENLPETHAVLKKIRATIDAEYPNRMLLAEANQWPEDVKEYFGDEDECHM
AFHFPLMPRIYMSIASEDRFPITDIMRQTPDLAATNQWAIFLRNHDELTLEMVTDSERDY
LWNTYASDRRARLNLGIRRRLAPLMERDRRRIELINSLLLSMPGTPVIYYGDELGMGDNI
HLGDRDGVRTPMQWSSDRNGGFSRADPEQLVLPPVMGSLYGFDAVNVEAQSRDPHSLLNW
TRRMLATRRAKQTFGRGTIRFLKPENRKILAYLREMPGEPPILCVANLSRAPQAVELDLS
EFNGSVPIEMTADSVFPAIGQLTYLLTFPPYGFLWFMLCPGGQRPTWAQAHSESLPEFVT
IVIREGQVGPTPENVRLLESEVLPSWLSRRRWFASKDQKLNAVRLAALTTIPHGGFAFTE
IEADVGGHTERYVVPIAITWGGETTFPLFKQLAFARVRRGRNVGHLTDAFALPIFAHGVM
RKLRERAVVPTVQKSEIKFLPTERFAELEGLGERPEIRWLAAEQSNSSLIIADTVVLKLV
RRLVSGIHPEAEISRYLTQLGYANTAPLYGEVVRVDPEGVPHTLCILQGYIENQGDAWNW
SLDYLRRSVDELAIAVDTEAQSAPDRTNEAILLEGYSSLAGTIGRRLGELHVALASPTDD
PAFAPEPASAEQVKAWVDGTQAMLASALDLLAPRIEQMSDPETKALAQSLIDRRKELVAA
VDNLVSADAGALRIRIHGDFHLGQVLVAQGDAFLIDFEGEPARSLEERRQKSSPLRDVAG
LMRSLSYASAAAQSTTEAAPQQTADRKRALFDRFRAHATETFLSEYRAAAAEAATPLVAP
EAEQALLDLFLIEKAAYEIRYEAANRPTWLSLPVRGLAALTSRLLGDTGAPGHDSPTQAP
GAATPPNPAEGDYE
NT seq 3465 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtgacgacccagctgaaacaacgacacaatcaccggtgggcaatgctcctggc
aacacggccaagccgcgcaccaatcggcgcggcaaacccgcggccttgagcgacgatccg
ctctggtacaaagacgcgatcatctatcaggtgcacatcaagtcgttcttcgacgcgaat
aacgacggcgtcggcgactttcccggcctgatcgcgaagctcgactacattgccgaactc
ggtgtgaacgcgatctggctgttgccgttctatccgtcgccacgacgcgacgacggttac
gacatcgccgactatcgcaacgtgcacccggactacggcaacctgtccgacgtgaagcgc
ttcattcaggaagcgcacgcacgcggcattcgcgtgattacggagctggtgatcaaccac
acgtcggatcagcacccgtggtttcagcgcgcgcgccgcgcgaagcccggctcgaatcac
cgtaactactacgtgtggtcggacaccgatcagaagtaccaggaaacgcggatcatcttc
atcgactcggagccgtccaactggacgcacgatccggtggcgggcgcgtattactggcac
cgcttctactcgcaccagcccgatctgaatttcgacaatccggccgtgctgaaagaagtg
ctgcaggtgatgcgcttttggctcgatatgggcatcgacgggctgcggctcgacgcggtg
ccgtatctggtggaacgtgaaggcacgaacaacgagaacctgccggaaacgcacgcggtt
ctgaagaaaatccgcgccaccatcgacgccgaatatccgaaccggatgctgctcgccgaa
gccaaccagtggccggaagacgtgaaggaatatttcggcgacgaagacgaatgccacatg
gcgttccacttcccgctgatgccgcgcatctacatgtcgattgcgagcgaagaccgcttc
ccgatcaccgacatcatgcggcaaacgccggatctcgccgcaacgaatcaatgggcgatt
ttcctgcgcaatcacgacgagctgacgctggaaatggtcacggattccgagcgcgactat
ttgtggaacacctacgcaagcgatcgccgcgcgcgcctgaatctcggcattcgccgtcgc
ctcgcgccgctcatggagcgcgaccgccgccgtatcgagctgatcaattcgctgctgctt
tccatgcccggcacgcccgtgatctattacggcgacgaactcggcatgggcgacaacatc
cacctgggcgaccgcgacggcgtgcgtacgccgatgcagtggtcgtcggatcgcaacggc
ggattttcgcgcgccgaccctgagcaactggtgctgccgccggttatgggctcgctatac
ggtttcgacgcggtgaacgtggaagcgcagagccgcgacccacactcgctgctgaactgg
acccggcgcatgctcgccacgcgccgcgcgaaacagactttcggacgcggcacgatccgc
ttcctgaaaccggaaaaccgcaagattctcgcgtatctgcgcgagatgccaggcgaaccg
ccgatcctgtgcgtggcgaatctttcgcgtgcgccgcaagcggtggagctcgatctgtcc
gagttcaacggctcagtgccgatcgaaatgactgcggattccgtgttcccggccatcggt
caactgacttatctgctgacgttcccgccgtacggttttctgtggttcatgctgtgcccg
ggcggccagcgtccgacgtgggcacaggctcattcggaatcgctgccggaattcgtcacg
atcgtgatccgcgaaggccaggtcggtccgacgccggagaacgtgcgtctgctcgaatcg
gaagtgttgccttcgtggctgagccggcgccgctggtttgcgtcgaaggatcagaagctc
aatgcggtgcggctcgcggcattgaccacgattccgcacggcggcttcgccttcactgaa
atcgaagcggacgtaggcggtcataccgaacgctacgtggtgccgatcgcgattacgtgg
ggcggcgaaaccactttcccgctgttcaagcaactggccttcgcgcgcgtgcggcgcggc
cgcaacgtggggcatctgacggacgcgtttgccttgccgatcttcgcgcatggcgtgatg
cgcaagctgcgcgaacgcgccgtggtgccgaccgtgcagaagagcgaaatcaagtttctg
ccgaccgagcgtttcgccgaactcgaagggctcggcgaacggccggagattcgttggctc
gcggccgagcaaagcaatagttcgttgatcatcgccgacacggtcgtgctgaagctggtg
cggcgcctcgtaagcggtatccatccggaagccgaaatcagccgctatctgacgcaattg
ggctacgcgaacaccgcgccgctgtatggcgaagtggtgcgcgtcgatcccgaaggcgtg
ccgcacaccctctgtatcctgcaaggctatatcgagaatcagggcgacgcgtggaactgg
tcgctcgactatctgcgccgctcggtggacgaactcgccatcgccgtcgacaccgaagcg
cagtcggcgccggaccgcaccaatgaggcaattctgctggaaggttatagctcgttggcc
ggcacgattggcagaaggctgggcgaactgcacgtggcgctcgcctcgccgacggacgac
ccggcgttcgcgccggaacccgccagcgcggagcaggtgaaggcatgggtggacggcacg
caggcgatgctcgccagcgcgctcgatctgctcgcgccgcgcatcgagcagatgagcgat
ccggaaaccaaagcgctggcgcaaagcctcatcgaccgccgcaaggaactggtggccgcc
gtcgacaatctcgtttccgccgacgcaggcgcgctacgcatccgcattcacggcgacttc
catctgggccaggtgctggtcgcgcagggcgacgcatttttgatcgacttcgaaggcgag
ccggcacgctcgcttgaagaacgtcgtcagaaatcgagcccgctgcgtgacgtggcaggt
ctgatgcgctcgttgtcgtatgcgagcgcggcagcgcagtccaccacggaagccgcgccg
caacagaccgccgatcgcaagcgcgcgctgttcgaccgtttccgcgcgcatgccacggaa
acgttcctcagcgagtaccgcgcagcggcagcggaagcagcaacaccgctcgtcgcgccc
gaagccgaacaggccttgctcgatctgttcctgatcgaaaaagccgcctacgaaatccgt
tacgaagcggccaaccgcccgacgtggctcagcttgccggtacgcggcctcgccgcgctc
accagccgcttgctcggcgacaccggcgcgccaggccacgattccccaacccaggcgcca
ggcgccgccacaccgcctaatccggccgagggcgactatgagtga

DBGET integrated database retrieval system