KEGG   Burkholderia pyrrocinia: ABD05_02150Help
Entry
ABD05_02150       CDS       T03962                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bpyr  Burkholderia pyrrocinia
Pathway
bpyr00620  Pyruvate metabolism
bpyr00680  Methane metabolism
bpyr00710  Carbon fixation in photosynthetic organisms
bpyr01100  Metabolic pathways
bpyr01120  Microbial metabolism in diverse environments
bpyr01200  Carbon metabolism
Module
bpyr_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bpyr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABD05_02150
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    ABD05_02150
   00680 Methane metabolism
    ABD05_02150
Enzymes [BR:bpyr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ABD05_02150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AKL99095
UniProt: A0A0G3WMI3
LinkDB All DBs
Position
1:459971..462985
Genome map
AA seq 1004 aa AA seqDB search
MKSSGSARTARRNAALSSSDAPTDTVAIAANGRAKTATKPKDPIHQTKRATKAAGPAART
AGAPKSGTRTREDKDGPLFEDIRFLGRLLGDVVREQEGDTVFDVVETIRQTAVKFRREDD
SEAAQTLEKKLRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSAPQPGTV
AYALDQLKTTGNASKRLLQRFFDDALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQE
LTARERQYNESMLRARVTALWQTRMLRDARLTVGDEIENALSYYRATFLDELPALYGDIE
AALAEHGLQARVPAFFQMGSWIGGDRDGNPNVTAATLDEAINRQAAVILEHYLEQVHKLG
AELSVSNLLVGANDAVKALAAASPDQSPHRVDEPYRRALIGIYTRLAASARVRVGEGTVP
VRSAGRGAPPVRAIPYADSEAFVADLKVLTASLDEHHGTSLAAPRLAPLVRAAEVFGFHL
ASIDLRQSSDIHEAVVAELFARAGVEADYAALAEEDKLRVLLAALADPRPLRSPYFEYSA
LAQSELGVFEKAREVRAQFGARAVRNYIISHTETVSDLVEVLLLQKETGLLEGALGVPGG
HARNSLMVIPLFETIPDLRDASRIMREYFALPGVDALIAHQGAEQEVMLGYSDSNKDGGF
LTSNWELYRAELALVDLFRDRKITLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRL
TEQGEVIASKFANPEIGRRNLETVVAATLEASLLPQSNAPAQLPAFEAAMQTLSDSAMAA
YRALVYETPGFTDYFFSSTPITEIAELNIGSRPASRKLQDPKQRKIEDLRAIPWGFSWGQ
CRLLLTGWYGFGSAVSAYLDGAQDEAERTKRVALLKKMNKTWPFFSNLMSNMDMVLAKTD
LAVASRYAQLVSDRKLRKHVFERIVAEWERTAQALAEITGHEGRLATNPLLARSIKNRFP
YLDPLNHLQVELIKRHRAGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcttccggatcggcgcgtacggcgcgccgcaatgctgccctgtcctcctccgac
gccccgacggacaccgtcgccatcgccgcgaacggccgtgcgaaaacggcaacgaaaccg
aaagacccgatacatcagacaaaacgcgcgacgaaagccgccggccccgcggcccgcacg
gccggcgcgccgaagtccggcacgcgcacgcgcgaggacaaggacggcccgctgttcgag
gacatccgcttcctcggccgcctgctcggcgacgtcgtgcgcgagcaggaaggcgacacc
gtgttcgacgtcgtcgagacgatccgccagaccgcggtcaagttccgccgcgaggacgac
agcgaagccgcgcagacgctcgagaagaagctgcgcaagctgacgccggagcagacggtg
agcgtcgtgcgcgcgttcagctatttctcgcatctcgcgaacatcgcggaagaccgccac
cacaaccgccgccgccgcatccacgcgctggccggctccgcaccgcagcccggcacggtc
gcgtacgcgctcgatcagctgaagacgaccggcaacgcgtcgaagcggctgctgcagcgc
ttcttcgacgacgcgctgatcgtgccggtgctgaccgcgcacccgaccgaagtgcagcgc
aagagcatcctcgacgcgcagcacgacatcgcacgcctgctggccgagcgcgaccaggaa
ctgaccgcgcgcgagcgccagtacaacgaatcgatgctgcgcgcgcgcgtgaccgcgctg
tggcagacgcgcatgctgcgcgacgcgcgcctgacggtcggcgacgagatcgagaacgcg
ctgtcgtactaccgcgcgaccttcctcgacgagctgcccgcgctgtacggcgacatcgag
gccgcgctcgccgagcacggcctgcaggcgcgcgtgcccgcgttcttccagatgggcagc
tggatcggcggcgatcgcgacggcaacccgaacgtgacggcggcgacgctcgacgaggcg
atcaaccgccaggccgcggtgatcctcgagcactatctggaacaggtgcacaagctcggc
gccgagctgtcggtgtcgaacctgctcgtcggcgcgaacgacgccgtgaaggcgctcgcc
gccgcatcgcccgaccagtcgccgcaccgcgtcgacgagccgtatcgccgcgcgctgatc
ggcatctacacgcggctcgccgcgagcgcacgcgtgcgcgtgggcgaaggcacggtgccc
gtgcgcagcgcgggccgcggcgcgccgcccgtgcgcgcgatcccgtatgcggattccgaa
gcgttcgtcgccgatctgaaggtgctgaccgcgtcgctcgacgaacaccacggcacgtcg
ctcgccgcgccgcgcctcgcgcctctcgtgcgcgcggccgaagtgttcggcttccatctc
gcgagcatcgacctgcgccagagctccgacatccatgaagcggtggtcgccgagctgttc
gcgcgcgcgggcgtcgaggccgactacgcggcgctcgccgaggaagacaagctgcgcgtg
ctgctcgccgcactcgccgacccgcgcccgctgcgttcgccgtacttcgaatactcggcg
ctcgcgcagagcgagctcggcgtgttcgagaaggcgcgcgaagtgcgtgcgcaattcggc
gcgcgcgcggtgcgcaactacatcatttcgcatacggaaaccgtcagcgacctcgtcgag
gtgctgctgctgcagaaggagacggggctgctcgaaggtgcgctcggcgtgccgggcggc
catgcgaggaacagcctgatggtgatcccgctgttcgagacgatccccgacctgcgcgac
gcatcgcgcatcatgcgcgaatacttcgcactgccgggcgtcgatgcgctgatcgcgcac
cagggtgccgagcaggaagtgatgctcggctactcggacagcaacaaggacggcggcttc
ctcacgtcgaactgggagctgtatcgcgcggaactcgcgctcgtcgacctgttccgcgac
cgaaagatcacgctgcggctgttccacggccgcggcggcacggtcggccgcgggggcggc
ccgacctaccaggcgatcctgtcgcagccgccgggcaccgtgaacggccagatccgcctg
accgaacagggcgaggtgatcgcgagcaagttcgcgaaccccgagatcggccggcgcaac
ctcgagacggtcgtcgccgcgacgctcgaggcgtcgctgctgccgcagtcgaacgcccct
gcgcaactgcccgcgttcgaggccgcgatgcagacgctgtccgactcggcgatggccgcg
taccgcgcgctcgtctatgaaacgcccggcttcaccgactacttcttctcgtcgacgccg
attaccgagatcgccgagctgaacatcggcagccgcccggcttcgcgcaagctgcaggat
ccgaagcagcgcaagatcgaggatctgcgcgcgattccgtggggcttctcgtggggccag
tgccggctgctgctgacgggctggtacggcttcggcagcgcggtgagcgcgtatctcgac
ggcgcgcaggatgaagccgagcgcacgaagcgcgtcgcgctgctgaaaaagatgaacaag
acctggccgttcttctcgaacctgatgtcgaacatggacatggtgctggcgaagaccgac
ctcgcggtcgcgtcgcgctacgcgcagctggtctccgaccgcaagctgcgcaagcatgtg
ttcgagcggatcgtcgcggaatgggagcgcacggcgcaggcgctggcggaaatcaccggg
cacgaaggccgcctcgcgaccaacccgctgctcgcgcgatcgatcaagaaccgcttcccg
tatctcgatccgctgaaccacctgcaggtcgagctgatcaagcgtcaccgcgcgggcgac
acgaacgcgcggctgcgccgcgggattcacctgacgatcaacgggatcgcggccggcctg
cgcaacacgggctga

DBGET integrated database retrieval system