KEGG   Burkholderia pyrrocinia: ABD05_07620Help
Entry
ABD05_07620       CDS       T03962                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
bpyr  Burkholderia pyrrocinia
Pathway
bpyr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bpyr01100  Metabolic pathways
bpyr01110  Biosynthesis of secondary metabolites
bpyr01130  Biosynthesis of antibiotics
bpyr01230  Biosynthesis of amino acids
Module
bpyr_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bpyr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ABD05_07620
Enzymes [BR:bpyr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     ABD05_07620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 APS_kinase AAA AAA_16 FtsK_gamma TsaE Cytidylate_kin AAA_22
Motif
Other DBs
NCBI-ProteinID: AKM00075
UniProt: A0A0G3WRF7
LinkDB All DBs
Position
1:1650930..1651484
Genome map
AA seq 184 aa AA seqDB search
MQARDPHANVFFVGLMGAGKTTVGRAVARRLDRTFFDSDHEIEARTGARIPVIFELEGEA
GFRDRETQVIADLTQRENIVLATGGGAVLRPENRDCLKSNGIVVYLRANPHDLWLRTRKD
KNRPLLQTEDPKGRLEALYEVRDPLYRECADFVIETGRPSVNGLVNMVLMQLELAGVIAK
PLQA
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagcgcgggacccacatgcaaacgtatttttcgtcggccttatgggagcgggtaag
accaccgtgggccgtgcggtcgcgcgtcgtctcgacaggacgttcttcgactccgaccac
gaaatcgaggcccgcacgggcgcgcgcattccggtgatcttcgagctggagggcgaggcc
gggtttcgcgatcgcgaaacgcaggtgatcgccgatctgacgcagcgcgagaacatcgtg
ctcgcgacgggcggcggcgcggtgctgcgcccggaaaatcgcgattgcctgaaaagcaat
ggcatcgtcgtttatctgcgtgccaatccgcacgatctgtggctgcgcacgcgcaaggac
aagaaccgcccgctgctgcagaccgaagatccgaaggggcgcctcgaagcgctctacgaa
gtgcgcgacccgctgtaccgcgaatgcgcggatttcgtcatcgagaccggccgcccgtcg
gtcaacggcctcgtcaacatggtgctgatgcaactcgaactggcgggcgtcatcgccaag
ccgctacaagcatga

DBGET integrated database retrieval system