KEGG   Burkholderia pyrrocinia: ABD05_13335Help
Entry
ABD05_13335       CDS       T03962                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bpyr  Burkholderia pyrrocinia
Pathway
bpyr00020  Citrate cycle (TCA cycle)
bpyr00310  Lysine degradation
bpyr00380  Tryptophan metabolism
bpyr01100  Metabolic pathways
bpyr01110  Biosynthesis of secondary metabolites
bpyr01120  Microbial metabolism in diverse environments
bpyr01130  Biosynthesis of antibiotics
bpyr01200  Carbon metabolism
Module
bpyr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpyr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpyr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABD05_13335 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    ABD05_13335 (sucA)
   00380 Tryptophan metabolism
    ABD05_13335 (sucA)
Enzymes [BR:bpyr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     ABD05_13335 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AKM01101
UniProt: A0A0G3WTB7
LinkDB All DBs
Position
1:2918191..2921055
Genome map
AA seq 954 aa AA seqDB search
MSDVMKQFQLNSYLFGGNASYVEELYDAYLNNPASVPENWREYFDALQNVPATDGSNAND
VAHFPIVESFAERAKANAFIPRESGTNLAAARKQVHVQSLISAYRFLGSQWANLDPLKRR
ERPAIPELEPAFYDFSEGDLDQTYSASNLYFGFDQASLRDIVKGLRDTYCGTIGAEYMYI
SDPEQKRWWQERLESTRATPNFSTGEKKHILNRLTAAEGLERYLHTKYVGQKRFSLEGGE
SFIAAMDEVVQHAGKRGVQEIIIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPAG
DVKYHKGFSSDVSTQGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDEDGLQVLPVQ
IHGDAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDARSTLYCTDVVK
MIEAPVLHVNGDDPEAVILATQIAIDYRMQFHKDVVIDIVCFRKLGHNEQDTPAVTQPLM
YKKIAQHPGTRALYAEKLVQQGVITAEDADNFVKAYRKAMDDGHHTVDPVLSNYKSKYAV
DWVPFLNRKWTDAADTAVPLAELKRLGERITTVPENFKVHPLVERVINDRRNMARGDQPL
DWGMGEHLAFASLVASGYSVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNIAE
GQAKFTVIDSVLSEEAVLGFEYGYSTAEPNTLVLWEAQFGDFVNGAQVVIDQFISSGEVK
WGRVSGLTMLLPHGYEGQGPEHSSTRIERFLQLCADHNMQVVQPTTPAQIFHLLRRQMIR
LFRKPLIVATPKSLLRHKEAVSDLSELAKGSFQPVIGETDGGIDAKKVKRVLACSGRVYY
DLVAHRREAKANDVAIIRIEQLYPFAHKQFEAEMKKYENATEVVWVQDEPQNQGPWFYVE
HHLKEGMKEGQKLAYSGRPASASPAVGYYAKHYEQQKALIEGAFGRLKSASIAK
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtaatgaagcagtttcagctgaactcctatctgttcggcggcaatgcttcg
tacgttgaagaactgtacgatgcatatctcaacaatccggcgtcagtgccagagaactgg
cgagagtatttcgacgcgctgcagaatgtgcctgcaacggacggttcgaatgccaatgac
gtcgcgcatttcccgatcgtcgagtcgtttgccgagcgtgcgaaggccaatgccttcatc
ccgcgcgaaagcggcaccaatctggctgcagcgcgcaagcaggttcacgtccagtccctc
atcagcgcttatcgcttccttggttcgcaatgggccaatctggatccgctgaagcgtcgc
gaacgtcccgccattcccgaactcgaacccgcgttctacgacttctccgaaggcgacctc
gaccagacgtacagcgcgagcaatctgtatttcggtttcgaccaggcttcgctgcgcgac
atcgtcaagggtctgcgcgacacgtactgcggcacgatcggcgccgagtacatgtacatc
agcgatccggagcagaagcgctggtggcaggaacgcctggaatcgacccgtgcgacgccg
aacttctcgacgggcgagaagaagcacatcctgaatcgcctcacggccgctgaaggcctc
gagcgctacctgcataccaagtacgtcggccagaagcgcttctcgctcgaaggcggcgaa
agcttcatcgcggcgatggacgaagtcgtccagcatgcgggcaagcgcggcgtgcaggaa
atcatcatcggcatggcccaccgcggccgtctgaacgtgctggtcaacacgctgggcaag
atgccggccgacctgttcgccgaattcgaaggcaagcacgtcgacgacctgccggccggc
gacgtgaagtaccacaagggcttctcgtcggacgtgtcgacgcaaggcggcccggttcac
ctgtcgctcgcgttcaacccgtcgcacctcgaaatcgtcaacccggtggtcgaaggttcc
gcgaaggcgcggatggaccgtcgcggcgacgaagacggcctgcaggtgctgccggtgcag
atccacggcgacgcggccttcgcgggccagggcgtcgtgatggaaacgctgaacctcgcc
cagacgcgcggttacggcacgcacggcacgctgcacatcgtcatcaacaaccagatcggc
ttcacgacgtccgacccgcgcgatgcgcgttcgacgctgtactgtaccgacgtcgtcaag
atgatcgaggcgccggtgctgcacgtgaacggcgacgatccggaagccgtgatccttgcg
acgcaaatcgcgatcgactaccggatgcagttccacaaggatgtcgtgatcgacatcgtc
tgcttccgcaagctgggtcacaacgagcaggacacgccggccgtcacgcagccgctgatg
tacaagaagatcgcgcagcacccgggcacccgtgcgctgtacgccgagaagctcgtgcag
cagggcgtgatcaccgcggaagacgccgacaacttcgtgaaggcgtaccgcaaggcgatg
gacgacggtcaccacacggtcgacccggtcctgtcgaactacaagagcaagtacgcggtc
gactgggttccgttcctgaaccgcaagtggacggatgcagccgacacggccgtgccgctc
gccgaactgaagcgcctcggcgaacgcatcacgacggtcccggaaaacttcaaggtccac
ccgctcgtcgagcgcgtgatcaacgaccgccgcaacatggcgcgcggcgaccagccgctc
gactggggcatgggcgagcacctcgcgttcgcgtcgctcgtcgcatcgggctactcggtg
cgcctgacgggccaggactcgggccgcggcacgttcacgcaccgtcacgcggtgctgcac
gaccagaaccgcgagcgctggaacgacggcacgtacgtgccgctgcagaacatcgccgaa
ggccaggcgaagttcacggtgatcgactcggtgctgtcggaagaagcggtgctgggcttc
gaatacggttactcgaccgccgagccgaacacgctcgtgctgtgggaagcgcagttcggc
gacttcgtcaacggcgcgcaggtcgtgatcgaccagttcatctcgtcgggcgaagtgaag
tggggccgcgtgtcgggtctcacgatgctgctgccgcacggctacgaaggccagggtccg
gagcactcgtcgacccgtatcgagcgtttcctgcaactgtgcgcggatcacaacatgcag
gtcgtccagccgacgacgccggcgcagatcttccacctgctgcgtcgccagatgatccgc
ctgttccgcaagccgctgatcgtcgcaacgccgaagtcgctgctgcgtcacaaggaagcg
gtgtcggacctgtcggaactggcgaagggttcgttccagccggtgatcggcgaaaccgac
ggcggcatcgacgcgaagaaggtcaagcgcgtgctggcatgctcgggccgcgtgtattac
gacctcgtcgcacatcgccgcgaagcgaaggcgaacgacgtcgcgatcatccgtatcgag
cagctgtatccgttcgcgcacaagcagttcgaagccgaaatgaagaagtacgagaacgcg
actgaagtggtctgggtgcaggacgagccgcagaaccagggcccctggttctacgtcgag
caccatctgaaggaaggcatgaaggaagggcagaagctggcatacagcggccgtccggct
tcggcctcgccggcggttggctactacgcgaagcactacgagcagcagaaggccctgatc
gaaggtgctttcggccgcctgaagagcgcatcgatcgcgaaataa

DBGET integrated database retrieval system