KEGG   Burkholderia pyrrocinia: ABD05_14905Help
Entry
ABD05_14905       CDS       T03962                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
bpyr  Burkholderia pyrrocinia
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF2007 DUF5061
Motif
Other DBs
NCBI-ProteinID: AKM01369
UniProt: A0A0G3WSR9
LinkDB All DBs
Position
1:complement(3269312..3270748)
Genome map
AA seq 478 aa AA seqDB search
MKIYDQFYIDGAWRKPAGTGTIDVIDSGTEAVIGRIPEGIASDAQDAIRAARAAFDAWAA
TPAATRAGYLRKIVERLQARSEELAQSITGEVGMPIKLSRAIQVGGPIYNWKAYAKLAES
FEFEAQVGNSLVVREPVGVVAAITPWNYPLNQVTLKVAPALAAGCTVVLKPSEVAPLNAF
MLAEAIHEAGLPAGVFNLVCGYGPVVGEVLATDPDVDMVSFTGSTRAGKRVAELAAAGVK
RVALELGGKSASVILDDADFATAVKGTVNACYLNAGQTCSAHTRMLVPEARYEEAREIAK
AAAETYVAGDPRQDATRLGALASAVQQQRVQAYIQRGIDEGAELVTGGTGLPEGLAKGFF
VKPTVFGRVDPKSTIAQEEIFGPVLSIITYRDEDEAVRIANDSPYGLGGAVWAGSDERAM
GIARRIRTGQVDINGGTWNGAAPFGGYKQSGHGRENGVYGLEEYLEYKSMQLKPTKPA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatctacgaccagttctatatcgacggtgcgtggcgcaaaccggccggaacgggc
acgatcgacgtgatcgactcgggcaccgaggccgtgatcggccggattccggagggcatc
gcatccgacgcgcaggatgcgatccgcgcggcgcgcgcggccttcgacgcgtgggcggcc
acgccggccgcgacgcgcgcgggctacctgcgcaagatcgtcgagcgtctgcaggcgcgc
agcgaggaactcgcgcagtcgatcacgggcgaagtcgggatgccgatcaagctgtcgcgc
gcgatccaggtcggcggcccgatatacaactggaaggcgtacgcgaagctcgccgagtcg
ttcgaattcgaggcgcaggtcggcaactcgctcgtggtgcgcgagccggtcggcgtcgtt
gcggcaatcacgccgtggaactacccgctcaaccaggtcacgctgaaggtcgcgccggcg
ctcgcggccggctgcacggtcgtcctgaagccgtccgaagtcgcgccgctcaacgcgttc
atgctcgccgaagcgattcacgaagccggcctgccggccggcgtgttcaacctcgtgtgc
ggctacggtccggtcgtcggcgaggtgctggccaccgacccggacgtcgacatggtgtcg
ttcacgggctcgacgcgcgctggcaagcgcgtggccgaactggcggccgcgggcgtcaag
cgcgtcgcgctcgagctgggcggcaagtcggcatcggtgatcctcgatgacgccgatttc
gcgacggcggtgaagggcacggtcaacgcgtgctacctgaacgcggggcagacctgctcg
gcgcacacgcggatgctggtgccggaagcgcgctacgaagaagcgcgcgagatcgcgaag
gccgcggccgaaacgtacgtcgcgggcgatccgcggcaggacgcgacgcgcctcggcgcg
ctcgcgtcggccgtgcagcagcagcgcgtgcaggcgtacatccagcgcgggatcgatgaa
ggcgcggaactcgtgacgggcggcacgggcctgccggaagggctcgcgaagggcttcttc
gtgaagccgaccgtgttcggccgggtcgatccgaaatcgacgatcgcgcaggaagagatc
ttcgggccggtgctgtcgatcatcacgtatcgcgacgaagacgaagccgtgcggatcgcg
aacgattcgccgtacgggctcggcggcgcggtatgggccggcagcgacgaacgcgcgatg
ggcatcgcacgccgcatccgcacggggcaggtcgacatcaacggcggcacgtggaacggc
gccgcgccgttcggcggctacaagcagtcggggcatggccgcgagaacggcgtgtacggg
ctcgaagagtatctcgagtacaagtcgatgcagttgaagccgacgaagccggcctga

DBGET integrated database retrieval system