KEGG   Burkholderia pyrrocinia: ABD05_15315Help
Entry
ABD05_15315       CDS       T03962                                 

Definition
(GenBank) DNA polymerase III subunits gamma and tau
  KO
K02343  DNA polymerase III subunit gamma/tau [EC:2.7.7.7]
Organism
bpyr  Burkholderia pyrrocinia
Pathway
bpyr03030  DNA replication
bpyr03430  Mismatch repair
bpyr03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bpyr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    ABD05_15315
   03430 Mismatch repair
    ABD05_15315
   03440 Homologous recombination
    ABD05_15315
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bpyr03032]
    ABD05_15315
   03400 DNA repair and recombination proteins [BR:bpyr03400]
    ABD05_15315
Enzymes [BR:bpyr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     ABD05_15315
DNA replication proteins [BR:bpyr03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     ABD05_15315
DNA repair and recombination proteins [BR:bpyr03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     ABD05_15315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_delta2 DNA_pol3_gamma3 DNA_pol3_tau_5 AAA RuvB_N AAA_16 AAA_30 AAA_5 AAA_14 AAA_22 AAA_assoc_2 DUF3646 TsaE AAA_18 Mg_chelatase AAA_24 DNA_pol3_delta
Motif
Other DBs
NCBI-ProteinID: AKM01442
UniProt: A0A0G3WRX2
LinkDB All DBs
Position
1:complement(3361997..3364354)
Genome map
AA seq 785 aa AA seqDB search
MTYQVLARKWRPKDFASLVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAK
ALNCETGVTSQPCGVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARF
KVYMIDEVHMLTNHAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPA
GHIVSHLERILGEEQITFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTESAVSGM
LGALDQTYMVRLLDALAAGGGPEILAIADEMSLRSLSFSTALQDLASLLHRIAWAQFAPG
SVLDEWPEAADLRRFAETLSPEQVQLFYQIATVGRAELGLAPDEYAGFTMTLLRMLAFEP
AVAAGSAPGGQPSVPRAVPGPRAAAASAAAAKPVSAAPVDAVRPQAAAPATPVAPVARSA
APAQSGDEAGRPVVKPATAPASAPASVDAQVVETPQPETNRAPQAATGGDQPPPARKEPE
QPAVAVAQRNDEPAAPAEPVPRAAPSEPAARPASRAGGAAAALDVLRNAGMRVSSDRARA
GAAPKPAVQPAAEKPAAPRPAVQVPTPRAAARAPQAADSRQASPPWEDIPPDDYVPLSAD
EMFGGPDDGFVPVFDSGPDDVRVSPKLAEARPAAPVDTRPLPPAIALDPVGFDGEWPALA
ARLPLKGVAYQLAFNSELTAVDATTLKLSVPVPQYADAAQVAKLKAALADALGKPVEVAV
EVGPARRTAAALDAAARAARQREAEQEIHGDPFVQQLVRDFGARIVEGSVRPLADSAPDG
PPPLH
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgacctatcaagttctcgcacgcaagtggcgtccgaaggatttcgcttcgctcgtcggc
caggagcacgtcgtcagggcgctcacgcacgcgctcgacggcgggcgtctccatcacgcc
tatctgtttaccggaacccgcggtgtcggcaagacgacgctgtcgcggatcttcgcgaag
gcactcaactgtgaaaccggcgtcacgtcgcaaccgtgcggcgtgtgtcgtgcctgtcgc
gagatcgacgaggggcgtttcgtcgattacgtcgaaatggatgccgcgagcaaccgcggc
gtcgacgaaatggccgcgctgctcgagcgcgcggtgtacgcgcccgtcgatgcgcgcttc
aaggtctacatgatcgacgaagtgcacatgctgacgaatcacgcgttcaacgcgatgctg
aagacgctcgaagagccgccgccgcacgtcaagttcatcctcgcgacgaccgatccgcag
aaaattcccgtcaccgtgctgtcgcgctgcctgcagttcaacctgaagcagatgccggcc
gggcacatcgtgtcgcatctcgagcggattctcggcgaagagcagatcacgttcgaaccg
caggcgctgcgcctgcttgcgcgtgccgcgcagggcagcatgcgcgacgcgctgtcgctc
accgaccaggcgatcgcctattcggcgaacgaggtgaccgagtcggccgtgtcgggcatg
ctcggcgcgctcgaccagacttacatggtgcgcctgctcgacgcgctcgcggccggcggc
ggcccggaaatcctcgcgattgccgacgagatgtcgctgcgcagcctgtcgttctcgacc
gcattgcaggatctcgcgagcctgctgcaccggattgcgtgggcgcagttcgcgccgggc
tcggtgctcgacgaatggccggaagcggccgacctgcgccgcttcgcggagacgctgagc
cctgagcaggttcaactgttctatcagatcgcgaccgtcggccgcgcggagctcggcctc
gcgccggacgaatacgccggtttcacgatgacgctgctgcggatgctcgcgttcgagccg
gccgttgccgcgggcagtgcgccgggcggccagccgtccgtgccgcgtgccgtgccgggc
ccgcgcgctgccgcggcgtcggccgctgccgcgaagccggtatcggctgcacccgtcgac
gcagtgcgcccgcaggctgccgcaccggctacacccgttgcaccggtcgcgcgatcagcg
gcaccggcacagtccggcgacgaagcaggccggccggtggtgaagccggctactgctccg
gcatccgcgccggcttcggttgatgcacaagttgtcgagacgccgcagccggaaacgaat
cgggcgccgcaagcggcgactggcggcgatcagccgccaccggcccgcaaggagcccgag
cagcctgccgttgccgttgcgcagcgaaacgacgaaccggctgcgccagccgaaccggtg
ccgcgcgctgcgccgtccgagcccgccgcgcgtccggcatcgcgagcaggcggtgctgcc
gctgcgctcgacgtgctgcgcaatgcggggatgcgcgtgtcgtccgaccgtgcgcgggca
ggcgcggccccgaagccggctgtccagccggccgccgagaaaccggccgcgccgcgtcca
gccgtgcaggtgccgacgccgcgcgctgccgcccgtgcgccgcaagcagccgattcgcgc
caggcttcgccgccgtgggaggacatcccgccggacgactacgtgccgctcagcgccgac
gagatgttcggcgggcccgatgatggcttcgttcccgtgttcgacagcggtcccgacgac
gtgcgcgtttcgccgaagctggcggaagcccgtccggccgcgccggtcgacacgcgcccg
ctgccgcccgcgatcgcgctcgatccggtcggcttcgacggcgaatggccggcgctggcc
gcgcggctgccgctcaagggtgtcgcataccagctcgcgttcaacagcgaactgacggcc
gtcgatgcgacgacattgaaactttccgtgccggtgccgcagtacgcggacgccgcgcag
gttgcgaagctgaaggccgcgctggccgacgcgctcggcaagccggtcgaagtagcggtc
gaggtcgggcccgcacggcgcacggcggcggcgctcgatgcggccgcgcgcgcggcgcgc
cagcgcgaggccgagcaggagattcacggcgatccgttcgtccagcagctcgtgcgcgac
ttcggtgcgcgcatcgtcgagggctcggtgcgtccgctcgccgattcggcgccggacggc
ccgccgccgctgcattga

DBGET integrated database retrieval system