KEGG   Burkholderia pyrrocinia: ABD05_18870Help
Entry
ABD05_18870       CDS       T03962                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bpyr  Burkholderia pyrrocinia
Pathway
bpyr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bpyr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ABD05_18870
Enzymes [BR:bpyr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ABD05_18870
Transporters [BR:bpyr02000]
 Other Transporters
  Pores ion channels [TC:1]
   ABD05_18870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4 Tom37
Motif
Other DBs
NCBI-ProteinID: AKM02319
UniProt: A0A0G3WVK2
LinkDB All DBs
Position
2:complement(593107..593724)
Genome map
AA seq 205 aa AA seqDB search
MKLYGFAGTRSQRALWGLKELDADFEFVSVNLLAGEHKRPEFLRINPAGKVPVLVDGDRV
IPESAAIVLYLADKFPEKALLPVDPAQRAQAYRWVMFAVTELEQPLWRITRHTFLYPPEK
RSPADIELAREDFGTMAAILDKHLEGREFIVGDTLTVADCVTAYLIDWASECNLIEPFPQ
LRAYLDRLYARPKAPQRIAEARKAA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttacggatttgccggcacccgctcgcaacgcgcgctgtgggggctgaaggaa
ctggatgcggatttcgagttcgtgtcggtcaacctgcttgcgggcgagcacaagcggccc
gaattcctgcgcatcaatccggccggcaaggtgccggtgctggtggacggcgaccgcgtg
attcccgagtcggccgcgatcgtgctgtatctcgcggacaagttcccggagaaggcattg
ctgccggtcgatccggcgcagcgcgcgcaggcctatcggtgggtcatgttcgcggtgacg
gagcttgaacagccgctgtggcggatcacgcggcacacgttcctttatccgccggagaag
cgctcgccggccgacatcgaactggcgcgcgaggatttcgggacgatggccgcgatcctc
gacaagcatctcgaagggcgcgagttcatcgtcggcgatacgctgacggtggccgattgc
gtgacggcctacctgatcgactgggccagcgaatgcaacctgatcgaaccgtttccgcaa
ctgcgggcgtatctcgaccggctgtatgcgcggccgaaggcgccgcagcggatcgcggag
gcgcgcaaggcggcgtga

DBGET integrated database retrieval system